KEGG   Macaca fascicularis (crab-eating macaque): 102125239Help
Entry
102125239         CDS       T02918                                 

Gene name
UGT2B23
Definition
UDP-glucuronosyltransferase 2B23-like (EC:2.4.1.17)
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Chemical carcinogenesis
Module
Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:mcf00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    102125239 (UGT2B23)
   00053 Ascorbate and aldarate metabolism
    102125239 (UGT2B23)
   00500 Starch and sucrose metabolism
    102125239 (UGT2B23)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    102125239 (UGT2B23)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    102125239 (UGT2B23)
   00860 Porphyrin and chlorophyll metabolism
    102125239 (UGT2B23)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102125239 (UGT2B23)
   00982 Drug metabolism - cytochrome P450
    102125239 (UGT2B23)
   00983 Drug metabolism - other enzymes
    102125239 (UGT2B23)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    102125239 (UGT2B23)
Enzymes [BR:mcf01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     102125239 (UGT2B23)
Glycosyltransferases [BR:mcf01003]
 Others
  Hydrophobic molecule
   102125239 (UGT2B23)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 529 aa AA seqDB search
MSVKWTSVILLIQLSFYFSSGSCGKVLVWAAEYSHWMNMKTILEELVQRGHEVTALASSA
SILFDPNNSSALKIEVFPTSLPKPEFENIVTQEIKRWIELPKDTFWLYFSQMQEIMWKFG
DIFRNFCKDVVSNKKLMKKLQESRFDVVFADPIFPCSELLAELFNIPLVYSLRFTPGYVF
EKHCGGFLFPPSYVPVVMSELSDQMTFMERVKNMIYMLYFDFCFQIYDMKKWDQFYTEVL
GRHTTLSEIMGKADIWLIRNSWNFQFPHPLLPNVDFIGGLLCKPAKPLPKEMEEFVQSSG
ENGVVVFTLGSMITNMKEERANVIASALAQIPQKVLWRFDGNKPDTLGVNTRLYKWIPQN
DLLGHPKTKAFITHGGANGIYEAIYHGVPMVGIPLFADQPDNIAHMKTRGAAVQLDFDTM
SSTDLVNALKTVINDPLYKENVMKLSRIQRDQPVKPLDRAVFWIEFVMRHKGAKHLRPAA
HDLTWFQYHSFDVIGFLLACVATVIFIIMKCCLFCFWKFARKGKKGKSD
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtgaaatggacttcagtaattctgctaatacaactgagcttttactttagctct
gggagttgtggaaaggtgctggtgtgggcagcagaatatagccattggatgaatatgaag
acaatcctggaagagcttgtccagagaggtcatgaggtgactgcactggcatcttcagct
tccattctttttgatcccaacaactcatccgctcttaaaattgaagtttttcctacatct
ttacctaaacctgagtttgagaatatagtcacgcaagagattaagagatggatagaactt
ccaaaagatacattttggttatatttttcacaaatgcaagaaatcatgtggaagtttggt
gacatatttagaaacttctgtaaagatgtagtttcaaataagaaattaatgaagaaacta
caagagtcaagatttgacgtcgtttttgcagatcctatttttccctgtagtgagctgctg
gctgagctatttaacataccacttgtgtacagtctccgcttcactcctggctatgttttt
gaaaagcattgtggaggatttcttttccctccctcctacgtacctgttgttatgtcagaa
ttaagtgatcaaatgactttcatggagagggtaaaaaatatgatctatatgctttatttt
gacttttgtttccaaatatatgacatgaagaagtgggatcagttttatactgaagttcta
ggaagacacactacattatctgagataatggggaaagctgacatatggcttattcgaaac
tcctggaattttcagtttccacatccactcttaccaaatgttgattttattggaggactc
ctctgcaaacctgccaaacccctacctaaggaaatggaagagtttgtacagagctctgga
gaaaacggtgttgtggtgtttactctggggtcaatgatcactaacatgaaagaagaaagg
gccaacgtaattgcatcagcccttgcccagattccacaaaaggttctgtggagatttgat
gggaataaaccagataccttaggtgtcaatactcggctctataagtggataccccagaat
gaccttctaggtcatccaaaaaccaaagcttttataactcacggtggagccaatggcatc
tacgaggcaatctaccatggggtccctatggtgggcattccactgtttgccgatcaacct
gataacattgctcacatgaaaaccagaggagcagctgttcaattggacttcgacacaatg
tcgagtacagacttggtgaatgcactgaagacagtaattaatgatcctttatataaagag
aatgttatgaaattatcaagaattcaacgtgatcagccagtgaagcccctggatcgagca
gtcttctggattgaatttgtcatgcgccacaaaggagctaaacaccttcggcctgcagcc
catgacctcacctggttccagtatcactctttcgatgtgattgggttcctgctggcctgt
gtggccactgtgatatttatcatcatgaaatgttgtctgttttgtttctggaagtttgct
agaaaaggaaagaagggaaaaagtgattag

  All links  
No link information was found.   
DBGET integrated database retrieval system