KEGG   Macaca fascicularis (crab-eating macaque): 102125403Help
Entry
102125403         CDS       T02918                                 

Gene name
UCHL5
Definition
(RefSeq) ubiquitin C-terminal hydrolase L5
  KO
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Brite
Enzymes [BR:mcf01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     102125403 (UCHL5)
Peptidases [BR:mcf01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   102125403 (UCHL5)
Ubiquitin system [BR:mcf04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UCH
    102125403 (UCHL5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
1
AA seq 521 aa AA seqDB search
MRVRDMEDWSDFARPWGRSHSTKGSQSASRNVLTCAWQPTPTWTRSAARRSPAQRWETTR
DGRPIGSDSDSNSPTAAGEFQAPALPNPLPVLHGLGRVSMSLGWLERPRALRRAAGDGAR
RLSGSRRGDVWWTSSAAGLLRSVAGGSWCGGRPRARGGSGRCVAGAMTGNAGEWCLMESD
PGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGSVVQDSRL
DTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSD
VIRQVHNSFARQQMFEFDTKTSAKEEDAFHFVSYVPVNGRLYELDGLREGPIDLGACNQD
DWISAVRPVIEKRIQKDGFSPCCPGWSQTPELKPSACLDLPKWYSEGEIRFNLMAIVSDR
KMIYEQKIAELQRQLAEEPMDTDQGNSMLSAIQSEVAKNQMLIEEEVQKLKRYKIENIRR
KHNYLPFIMELLKTLAEHQQLIPLVEKAKEKQNAKKAQETK
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgagggtgagagacatggaggactggtcagactttgcgcgtccctggggccgctcacac
agcacaaaaggctcccagtcggcttcccgcaatgtcctcacctgtgcctggcagccgacc
cccacctggacccgcagcgccgccaggagaagtcctgcgcagcgctgggaaacgacaaga
gacggcagaccgataggcagcgacagcgacagcaacagccccactgccgccggggaattc
caggccccagcccttccgaatccgctaccggtgctgcacggcctgggaagagtttcgatg
tctctagggtggctagagcgtcctcgcgcgctccgtcgcgctgcaggtgacggcgcccgg
aggctgtcgggaagtaggcggggtgacgtgtggtggacgagctcggcggcgggtttgctg
agatctgtggctggcggcagctggtgcggggggcggccgagagcgagaggtggatcgggg
cggtgtgtggccggggccatgacgggcaatgccggggagtggtgcctcatggaaagcgac
cccggggtcttcaccgagctcattaaaggattcggttgccgaggagcccaagtagaagaa
atatggagtttagagcctgagaattttgaaaaattaaagccagttcatgggttaattttt
cttttcaagtggcagccaggagaagaaccagcaggctctgtggttcaggactcccgactt
gacacaatattttttgctaagcaggtaattaataatgcttgtgctactcaagccatagtg
agtgtgttactgaactgtacccaccaggatgtccatttaggcgagacattatcagagttt
aaagaattttcacaaagttttgatgcagctatgaaaggcttggcactgagcaattcagat
gtgattcgacaagtacacaacagtttcgccagacagcaaatgtttgaatttgatacgaag
acatcagcaaaagaagaagatgcttttcattttgtcagttatgttcctgttaatggaaga
ctgtatgaattagatggattaagagaaggaccgattgatttaggtgcatgcaatcaagat
gattggatcagtgcagtaaggcctgtcatagaaaaaaggatacaaaaagacgggttttca
ccatgttgcccaggctggtctcagactcctgagctcaagccatccgcatgcctcgacctc
ccaaagtggtacagtgaaggtgaaattcgatttaatttaatggccattgtgtctgacaga
aaaatgatatatgaacagaagatagcagagttacaacgacaacttgcagaggaacccatg
gatacagatcaaggtaatagtatgttaagtgctattcagtcagaagttgccaaaaatcag
atgcttattgaagaagaagtacagaaattaaaaagatacaagattgagaatatcagaagg
aagcataattatctgcctttcattatggaattgttaaagactttagcagaacaccagcag
ttaataccactagtagaaaaggcaaaagaaaaacagaacgcaaagaaagctcaggaaacc
aaatga

DBGET integrated database retrieval system