KEGG   Macaca fascicularis (crab-eating macaque): 102125755Help
Entry
102125755         CDS       T02918                                 

Gene name
KAT5
Definition
K(lysine) acetyltransferase 5
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
HTLV-I infection
Brite
KEGG Orthology (KO) [BR:mcf00001]
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    102125755 (KAT5)
Enzymes [BR:mcf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102125755 (KAT5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
14
AA seq 546 aa AA seqDB search
MAEVVSPVPGAGRREPGEVGRARGPPVADPGAALSPQGEIIEGCRLPVLRRNQDNEDEWP
LAEILSVKDISGRKLFYVHYIDFNKRLDEWVTHERLDLKKIQFPKKEAKTPTKNGLPGSR
PGSPEREVPASAQASGKTLPIPVQITLRFNLPKEREAIPGGEPDQPLSSSSCLQPNHRST
KRKVEVVSPATPVPSETAPASVFPQNGAARRAVAAQPGRKRKSNCLGTDEDSQDSSDGIP
SAPRMTGSLVSDRSHDDIVTRMKNIECIELGRHRLKPWYFSPYPQELTTLPVLYLCEFCL
KYGRSLKCLQRHLTKCDLRHPPGNEIYRKGTISFFEIDGRKNKSYSQNLCLLAKCFLDHK
TLYYDTDPFLFYVMTEYDCKGFHIVGYFSKEKESTEDYNVACILTLPPYQRRGYGKLLIE
FSYELSKVEGKTGTPEKPLSDLGLLSYRSYWSQTILEILMGLKSESGERPQITINEISEI
TSIKKEDVISTLQYLNLINYYKGQYILTLSEDIVDGHERAMLKRLLRIDSKCLHFTPKDW
SKRGKW
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggtggtgagtccggtgcccggggcggggcggagggagccaggggaggtgggt
agagcccgaggccccccagtagccgaccctggcgccgcgctgtctccccagggggagata
atcgagggctgccgcctacccgtgctgcggcggaaccaggacaacgaagatgagtggccc
ctggccgagatcctgagcgtgaaggacatcagtggccggaagcttttctacgtccattac
attgacttcaacaaacgtctggatgaatgggtgacgcacgagcggctggacctaaagaag
atccagttcccgaagaaagaggccaagacccccaccaagaacggacttcctgggtcccgt
cccggctctccagagagagaggtgccggcctcggcccaggcaagcgggaagaccttgcca
atcccggtccagatcacactccgcttcaacctgcccaaggagcgggaggccattcccggt
ggcgagcctgaccagccgctctcctccagctcctgcctgcagcccaaccaccgctcaacg
aaacggaaggtggaggtggtttcaccagcaactccagtgcccagcgagacagccccggcc
tcggtttttccccagaatggagcagcccgtagggcagtggcagcccagccaggacggaag
cgaaaatcgaattgtttgggcactgatgaggactcccaggacagctcagatggaatacca
tcagcaccacgcatgactggcagcctggtgtctgaccgaagccacgacgacatcgtcacc
cggatgaagaacatcgagtgcattgagctgggccggcaccgcctcaagccgtggtacttc
tccccgtacccacaggagctcaccacattgcctgttctctacctgtgcgagttctgcctc
aagtacggccgtagcctcaagtgtcttcagcgtcacttgaccaagtgcgacctacgacat
cctccaggcaatgagatttaccgcaagggcaccatctccttctttgagattgatggacgt
aagaacaagagttattcccagaacctgtgtcttttggccaagtgtttccttgaccataag
acactgtactatgacacagaccctttcctcttctacgtcatgacggagtatgactgtaag
ggcttccacatcgtgggctacttctccaaggagaaagaatcgacagaagactacaatgtg
gcctgcatcctaaccctgcctccctaccagcgccggggctacggcaagctgctgatcgag
ttcagctatgaactctccaaagtggaagggaaaacagggacccctgagaagcccctctca
gacctgggcctcctatcctatcgaagttactggtcccagaccatcctggagatcctgatg
gggctgaagtcagagagcggggagaggccacagatcaccatcaatgagatcagtgaaatc
accagcatcaagaaggaggatgtcatctccactctgcagtacctcaatctcatcaactac
tacaagggccagtacatcctcacactgtcagaggacatcgtggatggccatgagcgggct
atgctcaagcggctcctgcggatcgactccaagtgtctgcacttcactcccaaggactgg
agcaagagggggaagtggtga

DBGET integrated database retrieval system