KEGG   Macaca fascicularis (crab-eating macaque): 102126128Help
Entry
102126128         CDS       T02918                                 

Gene name
F13A1
Definition
coagulation factor XIII, A1 polypeptide
Orthology
K03917  
coagulation factor XIII A1 polypeptide [EC:2.3.2.13]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
Complement and coagulation cascades
Class
Organismal Systems; Immune system; Complement and coagulation cascades [PATH:mcf04610]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 732 aa AA seqDB search
MSETSRIAFGGRRAVPPNNSNAAEDDLPTLELQGVVPRGVNLQEFLNVTSIHLFKERWDT
NKVDHHTDKYENNKLIVRRGQSFYIQIDFNRPYDPRRDLFRVEYVIGRYPQENKGTYIPV
PIVSELQSGKWGAKIVMREDRSVRLSVQSSPECIVGKFRMYVAVWTPYGIIRTSRNPETD
TYILFNPWCEDDAVYLDNEKEREEYVLNDIGVIFYGEVNDIKTRSWSYGQFEDGILDTCL
YVMDRAQMDLSGRGNPIKVSRVGSAMVNAKDDEGVLVGSWDNIYAYGVPPSAWTGSVDIL
LEYQSSENPVRYGQCWVFAGVFNTFLRCLGIPARIVTNYFSAHDNDANLQMDIFLEEDGN
VNSKLTKDSVWNYHCWNEAWMTRPDLPVGFGGWQAVDSTPQENSDGMYRCGPASVQAIKH
GHVCFQFDAPFVFAEVNSDLIYITAKKDGTHVVENVDATHIGKLIVTKQIGGDGMMDITD
TYKFQEGQEEERLALETALMYGAKKPLSTEGVMKSRSKVDMDFEVENAVLGKDLKLTITF
RNNSHNHYTITAYLSANITFYTGVSKAEFKKETFDVTLEPLSFKKEAVLIQAGEYMGQLL
EQASLHFFVTARINETRDVLAKQKSTVLTIPKLIIKVRGAQVVGSDMIVTVEFTNPLKET
LRNVWIHLDGPGITRPMRKMFREIRPNSTVQWEEVCRPWVSGPRKLIASMSSDSLRHVYG
ELDVQIQRRPSM
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaaacctccagaatcgcctttggaggcaggagagcggttccaccaaataactct
aatgcagcggaagatgacctgcccacactggagcttcagggcgtggtgccccggggcgtc
aacctgcaagagtttcttaatgtcacgagcattcacctattcaaggagagatgggacact
aacaaggtggaccaccacactgacaagtatgaaaacaacaagctgattgtccgcagaggg
cagtctttctacattcagattgacttcaatcgtccatatgaccccagacgggatctcttc
agggtggaatacgtcattggtcgctacccacaggagaacaagggaacctacatcccagtg
cctatagtctcagagttacaaagtggaaagtggggggccaagattgtcatgagagaggac
aggtctgtgcggctgtccgtccagtcttcccccgaatgtattgtggggaaattccgcatg
tatgttgctgtctggaccccctatggcataattagaaccagtcgaaacccagaaacagac
acgtacattctcttcaatccttggtgtgaagatgatgctgtgtacctggacaatgagaaa
gaaagagaagagtatgtcctgaatgacattggggtaattttttatggagaggtcaatgac
atcaagaccagaagctggagctatggtcagtttgaagatggcatcctggacacttgcctg
tatgtgatggacagagcgcaaatggacctctctggaagagggaatcccatcaaagtcagc
cgtgtggggtctgcaatggtgaatgccaaagatgacgaaggtgtcctcgttggatcctgg
gacaatatctatgcctatggtgtccccccatcggcctggactggaagcgttgacattcta
ttggaataccagagctctgagaatccagtccgatatggccaatgctgggtttttgctggt
gtctttaacacatttttgcgatgccttggaataccagcaagaattgttaccaattatttc
tcagcccatgataatgatgccaatttgcaaatggacatcttcctggaagaagatgggaac
gtgaattccaaactcaccaaggattcagtgtggaactaccactgctggaatgaagcatgg
atgacaaggcctgaccttcctgtcggatttggaggctggcaagctgtggacagcaccccc
caggaaaatagtgatggcatgtatcggtgtggccccgcctcggttcaagccatcaagcac
ggccacgtctgcttccaatttgatgcaccttttgtttttgcagaggtcaacagcgacctc
atttacattacagctaagaaagatggcactcatgtggtggaaaatgtggatgccacccac
attgggaaattaattgtgaccaaacaaattggaggagatggcatgatggatattactgat
acttacaaattccaagaaggtcaagaagaagagagactggccctagaaacggccctgatg
tatggagctaaaaagcccctcagcacagagggtgtcatgaaatcgaggtccaaagttgac
atggactttgaagtggaaaatgccgtgctgggaaaagacctcaagctcaccatcaccttc
cggaacaacagccacaaccattacaccatcacagcttatctctcagccaacatcaccttc
tacaccggggtctcgaaggcagaattcaagaaggagacgttcgacgtgacgctggagccc
ttgtccttcaagaaagaggcggtactgatccaagccggcgagtacatgggtcagctgctg
gaacaagcgtccctgcacttctttgtcacagctcgcatcaatgagaccagggatgttctg
gctaagcaaaagtccaccgtgctgaccatccctaagctcatcatcaaggtccgtggcgct
caggtagttggttctgacatgattgtgacagttgaatttaccaatcctttaaaagaaacc
ctgcgaaatgtctggatacacctggatggtcctggaataacaagaccaatgaggaagatg
ttccgtgaaatccggcccaactccaccgtgcagtgggaagaagtgtgccggccctgggtc
tctgggcctcggaagctgatagccagcatgagcagtgactccctgagacatgtgtatggc
gagctggacgtgcagattcaaagacgaccttccatgtga

DBGET integrated database retrieval system