KEGG   Macaca fascicularis (crab-eating macaque): 102126139Help
Entry
102126139         CDS       T02918                                 

Gene name
mfUGT2B33
Definition
UDP-glucuronosyltransferase 2B33-like
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Chemical carcinogenesis
Module
Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:mcf00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    102126139 (mfUGT2B33)
   00053 Ascorbate and aldarate metabolism
    102126139 (mfUGT2B33)
   00500 Starch and sucrose metabolism
    102126139 (mfUGT2B33)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    102126139 (mfUGT2B33)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    102126139 (mfUGT2B33)
   00860 Porphyrin and chlorophyll metabolism
    102126139 (mfUGT2B33)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102126139 (mfUGT2B33)
   00982 Drug metabolism - cytochrome P450
    102126139 (mfUGT2B33)
   00983 Drug metabolism - other enzymes
    102126139 (mfUGT2B33)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    102126139 (mfUGT2B33)
Enzymes [BR:mcf01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     102126139 (mfUGT2B33)
Glycosyltransferases [BR:mcf01003]
 Others
  Hydrophobic molecule
   102126139 (mfUGT2B33)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 529 aa AA seqDB search
MSVKWTSIILLIQLSFYFSSGSCGKVLVWAAEYSHWMNMKTILEELVQRGHEVTVLASSA
SILFDPNNSSALKIEVFPTSLTKTEFENIIRQQIKRWSELPKDTFWLYFSQIQEIMWRFG
DISIKFCKDVVSNKKLMKKLQESRFDVVLADPIFPCSELLAELFNIPLVYSLRFTPGYVF
EKHCGGFLFPPSYVPVVMSELSDQMTFMERVKNMIYVLYFDFCFQLYDMKKWDQFYSEVL
GGHTTLSEIMGKADIWLIRNSWNFQFPHPLLPNVDFIGGLLCKPAKPLPKEMEEFVQSSG
ENGVVVFTLGSMITNMKEERANVIASALAQIPQKVLWRFDGNKPNTLGVNTRLYKWIPQN
DLLGHPKTKAFITHGGANGIYEAIYHGVPMVGIPLLADQPDNIAHMKARGAAVQLDFDTM
SSTDLANALKTVINDPLYKENVMKLSRIQHDQPVKPLDRAVFWIEFVMRHKGAKHLRPAA
HDLTWFQYHSLDVIGFLLACVATVIFIIMKCCLFCFWKFARKGKKGKSD
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtgaaatggacttcaatcattctgctaatacaactgagcttttactttagctct
gggagttgtggaaaggtgctggtgtgggcagcagaatatagccattggatgaatatgaag
acaatcctggaagagcttgtccagaggggtcatgaggtgactgtactggcatcttcagct
tccattctttttgatcccaacaactcatccgctcttaaaattgaagtttttcctacatct
ttaactaaaacggagtttgagaatatcatcaggcaacagattaagagatggtcagaactt
ccaaaagatacattttggttatatttttcacaaatacaagaaatcatgtggaggtttggt
gacataagtataaagttctgtaaagatgtagtttcaaataagaaattaatgaagaaacta
caagagtcaagatttgatgtcgttttagcagatcctatttttccctgtagtgagctgctg
gctgagctatttaacataccccttgtgtacagtctccgcttcactcctggctacgttttt
gaaaaacattgtggaggatttcttttccctccctcctacgtacctgttgttatgtcagaa
ttaagtgatcaaatgactttcatggagagggtaaaaaatatgatctatgtgctttatttt
gacttttgtttccaattgtatgacatgaagaagtgggatcagttttatagtgaagttcta
ggaggacacactacattatctgagataatggggaaagctgacatatggcttattcgaaac
tcctggaattttcagtttccacatccactcttaccaaatgttgattttattggaggactc
ctctgcaaacctgccaaacccctacctaaggaaatggaagagtttgtacagagctctgga
gaaaatggtgttgtggtgtttactctggggtcaatgatcactaacatgaaagaagaaagg
gccaacgtaattgcatcagcccttgcccagattccacaaaaggttctgtggagatttgat
gggaataaaccaaataccttaggtgtcaatactcggctctataagtggataccccagaat
gaccttctaggtcatccaaaaaccaaagcttttataactcacggtggagccaatggcatc
tacgaggcaatctaccatggggtccctatggtgggcattccactgcttgccgatcaacct
gataacattgctcacatgaaggccagaggagcagctgttcaattggacttcgacacaatg
tcgagtacagacttggcgaatgcactgaagacagtaattaatgatcctttatataaagag
aatgttatgaaattatcaagaattcaacatgatcaaccagtgaagcccctggatcgagca
gtcttctggattgaatttgtcatgcgccacaaaggagctaaacaccttcggcctgcagcc
catgacctcacctggttccagtaccactctttggatgtgattgggttcctgctggcctgc
gtggcaactgtgatatttatcatcatgaaatgttgtctgttttgtttctggaagtttgct
agaaaaggaaagaagggaaaaagtgattag

DBGET integrated database retrieval system