KEGG   Macaca fascicularis (crab-eating macaque): 102126460Help
Entry
102126460         CDS       T02918                                 

Gene name
PADI4
Definition
peptidyl arginine deiminase, type IV
Orthology
K01481  
protein-arginine deiminase [EC:3.5.3.15]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Brite
Enzymes [BR:mcf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.15  protein-arginine deiminase
     102126460 (PADI4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 668 aa AA seqDB search
MAQGTLIRVTPEQPTHAVCVLGTLTQLDVCSSAPEDCTSFSVNASPGVVVDIAHSPPAKK
KSTGSSTWPLDPGVEVTLTMKAASGSTGDQKVQISYHGPKTPPVKALLYLTGVEISLSAD
ITRTGKVKPTRAVEDKRTWTWGPCGQGAILLVNCDRDNPESSAMDCEDDEVLDSKDLKDM
SLMTLSTKTPQDFFTRHTLVLHVARSEMDKVRVFQATRGRLSSRCRVVLGPKQPSHYLMV
PGGKHNMDFYVEALAFPDTNFPGLITLTVSMLDTSKLELPEAVVFQDSVVFRVAPWIMTP
NTQPPQEVYVCSIFENEDFLKSVTALAMQARCKLTICPEEENMDDQWMQDEMEIGYIQAP
HKTLPVVFDSPRNRGLKEFPIKRVMGPDFGYVTRGPQTGGVSGLDSFGNLEVSPPVTVGD
KEYPLGRILFGDSCYPSSDSREMHQALQDFLSAQQVQAPVKLYSDWLTVGHVDEFLSFVP
APDRKCFCLQGFRLLLASPRSCYKLFQEQQNEGHGDALLFQGIKKKNQQKIKNILSNTTL
REHNSFVERCIDWNRELLKRELGLAESDIIDIPQLFKLKEFSKAEAFFPNMVNMLVLGKH
LGIPKPFGPIINGRCCLEEKVRSLLEPLGLHCTFINDFYTYHIRHGEVHCGTNVRRKPFS
FKWWNMVP
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atggcccaggggacattgatccgtgtgaccccagagcagcccacccatgccgtgtgtgtg
ctgggcaccttgactcagcttgacgtctgcagctctgcccctgaggactgcacgtccttc
agcgtcaacgcctctccaggggtggtcgtggatattgcccacagccctccagccaagaag
aagtccacaggttcctccacatggcccctggaccctggggtagaggtgaccctgacgatg
aaagcagccagtggtagcacaggcgaccagaaggttcagatttcataccatggacccaag
actccaccagtcaaagctctactctatctcaccggggtggaaatctccctgagcgcggac
atcacccgcaccggcaaagtgaagccaaccagagctgtggaagacaagaggacctggacc
tggggcccttgtggacagggtgccatcctgctggtgaactgtgacagagacaatcctgaa
tcttctgccatggactgtgaggatgacgaagtgcttgacagcaaagacctgaaggacatg
tccctgatgaccctgagcacgaagaccccccaggacttcttcactaggcatacactggtg
ctccacgtggccaggtctgagatggacaaagtgagagtgtttcaggccacacggggcaga
ctgtcctccaggtgcagggtagtcctgggtcccaagcagccctctcactacctgatggtc
ccaggcggaaaacacaacatggacttctacgtggaggccctcgctttccctgacaccaac
ttcccagggctcattaccctcaccgtctccatgttggacacgtccaaactggagctcccc
gaggctgtggtgttccaagacagcgtggtcttccgcgtggcgccctggatcatgacccct
aacacccagcccccgcaggaggtgtacgtgtgcagtatttttgaaaatgaggacttcctg
aagtcagtgactgctctggccatgcaagccaggtgtaagctgaccatctgccctgaggag
gagaacatggatgaccagtggatgcaggatgaaatggagatcggctacatccaagcccca
cacaaaacgctgccggtggtatttgactctccaaggaacagaggcctgaaggagtttccc
atcaaacgtgtgatgggtccagattttggctacgtaactcgagggccccaaacagggggt
gtcagtgggctggactcctttgggaacctggaagtgagccccccggtcacagtcggggac
aaggaatacccgctgggcaggattctctttggggacagctgttatcccagtagtgacagc
cgggagatgcaccaggccctgcaggacttcctaagcgcccagcaggtgcaggcccctgtg
aagctctattctgactggctgaccgtgggccacgtggacgagttcctgagctttgtgcct
gcacctgacaggaagtgtttctgcctccagggcttccggctgctcctggccagccccagg
tcctgctacaaactgttccaggagcagcagaatgagggccacggggatgccctgctgttc
caagggatcaagaaaaaaaaccagcagaaaataaagaacattctgtcaaacacgacattg
agagaacataattcatttgtggagagatgcattgactggaaccgcgagctgctgaagcgg
gagctgggcctggctgagagtgacatcatcgacattccgcagctcttcaagctcaaagag
ttctccaaggccgaagcctttttccccaacatggtgaacatgctggtgctggggaagcac
ctgggcatccccaagcccttcgggcccatcatcaacggccgctgctgcctggaggagaag
gtgcgatccctgctggagcctctgggcctccactgcactttcatcaatgacttctacacc
taccacatcaggcatggggaggtgcactgcggcaccaatgtgcgcagaaagcccttctcc
ttcaagtggtggaacatggtgccctga

DBGET integrated database retrieval system