KEGG   Macaca fascicularis (crab-eating macaque): 102127119Help
Entry
102127119         CDS       T02918                                 

Gene name
HAT1
Definition
histone acetyltransferase 1
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
Alcoholism
Brite
KEGG Orthology (KO) [BR:mcf00001]
 Human Diseases
  Substance dependence
   05034 Alcoholism
    102127119 (HAT1)
Enzymes [BR:mcf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102127119 (HAT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
12
AA seq 459 aa AA seqDB search
MPHALGPVSLPIPFVHCCLLQILYIWSCSRQLILMLRSPPLPGFGAMEKFLVEYKSAVEK
KLAEYKCNTNTAIELKLVRFPEDLENDIRTFFPEYTHQLFGDDETAFGYKGLKILLYYIA
GSLSTMFRVEYASKVDENFDCVEADDVEGKIRQIIPPGFCTNTNDFLSLLEKEVDFKPFG
TLLHTYSVLSPTGGENFTFQIYKADMTCRGFREYHERLQTFLMWFIETASFIDVDDERWH
YFLVFEKYNKDGATLFATVGYMTVYNYYVYPDKTRPRVSQMLILTPFQGQGHGAQLLETV
HRYYTEFPTVLDITAEDPSKSYVKLRDFVLVKLCQDLPCFSREKLMQGFNEDMAIEAQQK
FKINKQHARRVYEILRLLVTDMSDAEQYRSYRLDIKRRLISPYKKKQRDLAKMRKCLRPE
ELTNQMNQIEISMQHEQLEESFQELVEDYRRVIERLAQE
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgccacatgccttggggcctgtttctcttcccattccttttgtccactgctgcttgctt
cagatcttgtacatctggtcctgttcccgccagctgattttaatgctcagatctcctcct
cttccaggatttggtgctatggagaaatttttggtagaatataagagtgcagtggagaag
aaactggcagagtacaaatgtaacaccaacacagcaattgaactaaaattagttcgtttt
cctgaagatcttgaaaatgacattagaactttctttcctgagtatacccatcaactcttt
ggggatgatgaaactgcttttggttacaagggtctgaagatcctgttatactatattgct
ggtagcctgtcaacaatgttccgtgttgaatatgcatctaaagttgatgagaactttgac
tgtgtagaggcagatgatgttgagggcaaaattagacaaatcattccacctggattttgc
acaaacacaaatgatttcctttctttactggaaaaagaagttgatttcaagccattcgga
accttacttcatacctactcagttctcagtccaacaggaggagaaaactttacctttcag
atatataaggccgacatgacatgtagaggctttcgagagtatcatgaaaggcttcagacc
tttttgatgtggtttattgaaactgctagctttattgacgtggatgatgaaagatggcac
tactttctagtatttgagaagtataataaggatggagctacgctctttgcgaccgtaggc
tacatgacagtctataattactatgtgtacccagacaaaacccggccacgtgtaagtcag
atgctgattttgactccatttcaaggtcaaggccatggtgctcagcttcttgaaacagtt
catagatactacactgaatttcctacagttcttgatattacagcggaagatccatccaaa
agctatgtgaaattacgagactttgtgcttgtgaagctttgtcaagatttgccctgtttt
tcccgggaaaaattaatgcaaggattcaatgaagatatggcaatagaggcacaacagaag
ttcaaaataaataagcaacatgctagaagggtttatgaaattcttcgactactagtaact
gacatgagtgatgccgaacaatacagaagctatagactggatattaaaagaagactaatt
agcccatataagaaaaagcagagagatcttgctaagatgagaaaatgtctcagaccagaa
gaactgacaaaccagatgaaccagatagaaataagcatgcaacatgaacagctggaagag
agttttcaggaactagtggaagattaccggcgtgttattgagcgactcgctcaagagtaa

DBGET integrated database retrieval system