KEGG   Macaca fascicularis (crab-eating macaque): 102127332Help
Entry
102127332         CDS       T02918                                 

Gene name
PADI3
Definition
peptidyl arginine deiminase, type III
Orthology
K01481  
protein-arginine deiminase [EC:3.5.3.15]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 664 aa AA seqDB search
MSLQRIVRVSLEHPTSAVCVAGVETVVDIYGSVPEGTEMFEVYGTPGVDIYVSPNMERGR
ERADTRRWRFDATLEIIVVMNSPSNDLNDSHVQISYHSSHKPLPLAYAVLYLTCVDISLD
CDLNCEGRQDRTFVDKRQWVWGPRGYGGILLVNCDRDDPSCGVQDNCDEHVRCLQDLEDM
SVMVLRTQGPAALFDDHKLVLHTSSYDAERAQVFHVCGPEDMCEAYRHVLGQDKVSYEVP
RFHGDEERFFVEGLSFPDAGFTGLISFHVTLLDDSNEDFSASPIFTDTVVFRVAPWIMTP
STLLPLEVYVCRVRNNTCFVDAVAELARKAGCKLTICPQAENRNDRWIQDEMELGYVQAP
HKTLPVVFDSPRNGELQDFPYKRILGPDFGYVTREPRDRSVSGLDSFGNLEVSPPVVANG
KEYPLGRILIGGNLPGSSGRRVTQVVRDFLHAQKVQPPVELFVDWLAVGHVDEFLSFVPA
PDGKGFRMLLASPGACFKLFQEKRKCGHGRALLFQGVVDDERVRTISINQVLSNKDLINY
NKFVQSCIDWNREVLKRELGLAECDIIDIPQLFKTERKKAMAFFPDLVNMLVLGKHLGIP
KPFGPIIDGRCCLEEKVRSLLEPLGLHCTFIDDFTPYHMLHGEVHCGTNVRRKPFSFKWW
NMVP
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctgcagagaatcgtgcgtgtgtccctggagcatcccaccagcgcggtgtgtgtg
gctggcgtggagaccgtcgtggacatttatgggtcagtgcctgagggcacagagatgttc
gaggtctatgggacgcctggagtggacatctacgtctctcccaacatggagaggggccgg
gagcgtgcagacaccagacggtggcgctttgacgcgactttggagatcatcgtggtcatg
aactcccccagcaatgacctcaacgacagccatgttcagatttcctaccactccagccac
aagcctctgcccctggcctatgcggtgctctacctcacctgtgttgacatctctctggat
tgcgacctgaactgtgaaggaaggcaggacaggacctttgtagacaagcggcagtgggtc
tgggggcccagggggtatggtggcatcttgctggtgaactgtgaccgtgatgatccaagc
tgtggtgtccaggacaactgcgacgagcacgtgcgctgcctgcaagacctggaagatatg
tctgtcatggtcctgcggacgcagggccctgcagccctctttgacgaccacaaacttgtc
ctccacacctccagctatgatgccgaacgggcacaggtcttccatgtctgcggtcctgag
gatatgtgtgaggcctataggcatgtgctgggccaagacaaggtgtcctatgaggtaccc
cgcttccatggggacgaggagcgcttcttcgtggaaggcctgtccttccccgatgccggc
ttcacaggactcatctccttccatgtcactctgctggacgactccaacgaggatttctcg
gcatcccctatcttcactgacactgtggtattccgagtggcaccctggatcatgacaccc
agcaccctgctgcccctagaggtgtacgtgtgtcgtgtgaggaacaacacgtgttttgtg
gatgcggtggcagagctggccaggaaggccggctgcaagctgaccatctgcccacaggcc
gagaaccgcaacgaccgctggatccaggatgagatggagctgggctacgttcaggcgcca
cacaagaccctcccggtggtctttgactccccaaggaatggggaactgcaggatttccct
tacaaaagaatcctgggtccagattttggttacgtgacacgggaaccacgcgacaggtct
gtgagtggcctggactcctttgggaacctggaggtcagccccccagtggtggccaatggg
aaggagtaccccctggggaggatcctcattgggggcaacctgcctgggtcaagtggccgc
agggtcacccaggtggtgcgagacttcctccatgcccagaaggtgcagccccccgtggag
ctctttgtggactggttggccgtgggccacgtggatgagtttctgagcttcgtccctgcc
cccgatgggaagggcttccggatgctcctggccagccccggggcctgcttcaagctcttc
caggaaaagcggaagtgtggccacgggagggccctcctgttccagggggttgttgatgat
gagcgggtgaggaccatctccatcaaccaggtgctctccaataaagacctcatcaactac
aataagtttgttcagagctgcatcgactggaaccgtgaggtgctgaagcgggagctgggc
ctggccgagtgtgacatcatcgacatcccgcagctcttcaagaccgagaggaaaaaagca
atggccttcttccctgacttggtgaatatgctggtgctggggaagcacctgggcatcccc
aagcccttcgggcccatcatcgacggccgctgctgcctggaggagaaggtgcgatccctg
ctggagccgctaggcctccactgcaccttcattgatgacttcactccataccacatgctg
catggggaggtgcactgtggcaccaatgtgcgcagaaagcccttctccttcaagtggtgg
aacatggtgccctga

DBGET integrated database retrieval system