KEGG   Macaca fascicularis (crab-eating macaque): 102127901Help
Entry
102127901         CDS       T02918                                 

Gene name
UGT2B9
Definition
(RefSeq) UDP-glucuronosyltransferase 2B9-like
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf00040  Pentose and glucuronate interconversions
mcf00053  Ascorbate and aldarate metabolism
mcf00140  Steroid hormone biosynthesis
mcf00830  Retinol metabolism
mcf00860  Porphyrin and chlorophyll metabolism
mcf00980  Metabolism of xenobiotics by cytochrome P450
mcf00982  Drug metabolism - cytochrome P450
mcf00983  Drug metabolism - other enzymes
mcf01100  Metabolic pathways
mcf05204  Chemical carcinogenesis
Module
mcf_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:mcf00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    102127901 (UGT2B9)
   00053 Ascorbate and aldarate metabolism
    102127901 (UGT2B9)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    102127901 (UGT2B9)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    102127901 (UGT2B9)
   00860 Porphyrin and chlorophyll metabolism
    102127901 (UGT2B9)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102127901 (UGT2B9)
   00982 Drug metabolism - cytochrome P450
    102127901 (UGT2B9)
   00983 Drug metabolism - other enzymes
    102127901 (UGT2B9)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    102127901 (UGT2B9)
Enzymes [BR:mcf01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     102127901 (UGT2B9)
Glycosyltransferases [BR:mcf01003]
 Others
  Hydrophobic molecule
   102127901 (UGT2B9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_transf_4 Glyco_trans_4_4
Motif
Other DBs
NCBI-GeneID: 102127901
NCBI-ProteinID: NP_001270204
UniProt: O02663
Position
5
AA seq 529 aa AA seqDB search
MSVKWTSVILLIQLSFYFSSGSCGKVLVWAAEYSHWMNMKTILEELVQRGHEVTVLASSA
SILFDPNNSSALKIEVFPTSLTKTEFENISMQEVKRWIELPKDTFWLYFSQMQEIMWRFG
DIIRNFCKDVVSNKKLMKKLQESRFDVVFADPIFPCSELLAELFNIPLVYSLRFTPGYIF
EKHCGGFLFPPSYVPVVMSELSDQMTFMERVKNMIYMLSFDFYFQMYDMKKWDQFYSEVL
GRPTTLSETMGKADIWLIRNSWNFQFPHPLLPNVDFVGGLHCKPAKPLPKEMEEFVQSSG
ENGVVVFSLGSMVTNMEEERANVIASALAQIPQKVLWRFDGKKPDTLGLNTRLYKWIPQN
DLLGHPKTRAFITHGGANGIYEAIYHGVPMVGIPLFADQPDNIAHMKTKGAAVRLDFDTM
SSTDLANRLKTVINDPLYKENVMKLSRIQHDQPVKPLDRAVFWIEFVMRHKGAKHLRPAA
HDLTWFQYHSLDVIGFLLACVATVIFVIMKCCLFCFWKFARKGKKGKSD
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtgaaatggacttcagtaattctgctaatacaactgagcttttactttagctct
gggagttgtggaaaggtgctggtgtgggcagcagaatatagccattggatgaatatgaag
acaatcctggaagagcttgtccagagaggtcatgaggtgactgtcctggcatcttcagct
tccattctttttgatcccaacaactcatccgctcttaaaattgaagtctttcctacatct
ttaactaaaactgagtttgagaatatctccatgcaagaggttaagagatggatagaactt
ccaaaagatacattttggttatatttttcacaaatgcaagaaatcatgtggaggtttggt
gacataattagaaatttctgtaaagatgtagtttcaaataagaaattaatgaagaaatta
caagagtcaagatttgacgtcgtttttgcagatcctatttttccctgtagtgagctgctg
gctgagctatttaacataccccttgtgtacagtctccgcttcactcctggctacattttt
gaaaagcattgtggaggttttcttttccctccctcctacgtacctgttgttatgtcagaa
ttaagtgatcaaatgactttcatggagagggtaaaaaatatgatctatatgctttctttt
gacttttattttcaaatgtatgacatgaagaagtgggatcaattttatagtgaagttcta
ggaagacccactacattatctgagacaatggggaaagctgacatatggcttattcgaaac
tcctggaattttcagtttccacatccactcttaccaaatgttgattttgttggaggactc
cactgcaaacctgccaaacccctacctaaggaaatggaagagtttgtacagagctctgga
gaaaatggtgttgtggtgttttctctggggtcaatggtcactaacatggaagaagaaagg
gccaacgtaattgcatcagcccttgcccagatcccacaaaaggttctgtggagatttgat
ggaaaaaaaccggataccttaggcctcaatactcggctctataagtggataccccagaat
gaccttctaggtcatccaaaaaccagagcttttataactcacggtggagccaatggcatc
tatgaagcgatctaccatggggtccctatggtgggcattccattgtttgccgatcagcct
gataacattgctcacatgaagaccaaaggagcagctgttagattggacttcgacacaatg
tcgagtacagacttggcgaatcgactgaagacagtaattaatgatcctttatataaagag
aatgttatgaaattatcaagaattcaacatgatcaaccagtgaagcccctggatcgagca
gtcttctggattgaatttgtcatgcgccacaaaggagctaaacaccttcggcctgcagcc
catgacctcacctggttccagtatcactctttggatgtgattgggttcctgctggcctgt
gtggcaactgtgatatttgttatcatgaaatgttgtctgttttgtttctggaagtttgct
agaaaaggaaagaagggaaaaagtgattag

DBGET integrated database retrieval system