KEGG   Macaca fascicularis (crab-eating macaque): 102128382Help
Entry
102128382         CDS       T02918                                 

Gene name
KAT6B
Definition
K(lysine) acetyltransferase 6B
Orthology
K11306  
histone acetyltransferase MYST4 [EC:2.3.1.48]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Brite
Enzymes [BR:mcf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102128382 (KAT6B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
9
AA seq 2077 aa AA seqDB search
MVKLANPLYTEWILEAIQKIKKQKQRPSEERICHAVSTSHGLDKKTVSEQLELSVQDGSV
LKVTNKGLASYKDPDNPGRFSSVKPGTFPKSTKGSRGSCNDLRNVDWNKLLRRAIEGLEE
PNGSSLKNIEKYLRSQSDLTSTTNNPAFQQRLRLGAKRAVNNGRLLKDGPQYRVNYGSLD
GKGAPQYPSAFPSSLPPVSLLPHEKDQPRADPIPICSFCLGTKESNREKKPEELLSCADC
GSSGHPSCLKFCPELTTNVKALRWQCIECKTCSACRVQGRNADNMLFCDSCDRGFHMECC
DPPLSRMPKGMWICQVCRPKKKGRKLLHEKAAQIKRRYAKPIGRPKNKLKQRLLSVTSDE
GSMNAFTGRGSPGRGQKTKVCTTPSSGHAASGKDSSSRLAVTDPTRPGATTKITTTSTYI
SASTLKVNKKTKGLIDGLTKFFTPSPDGRRSRGEIIDFSKHYRPRKKVSQKQSCTSHVLA
TGTTQKLKPPPSSLPPPTPISGQSPSSQKSSTATSSPSPQSSSSQCSVPSLSGLTTNSQL
KALFDGLSHIYTTQGQSRKKGHPSYAPPKRMRRKTELSSTAKSKAHFFGKRDIRSRFISH
SSSSSWGMARGRIFKAIAHFKRTTFLKKHRMLGRLKYKVTPQMGTPSPGKGSLTDGRIKP
DQDDDTEIKINIKQESADVNVIGNKDVVTEEDLDVFKQAQELSWEKIECESGVEDCGRYP
SVIEFGKYEIQTWYSSPYPQEYARLPKLYLCEFCLKYMKSKNILLRHSKKCGWFHPPANE
IYRRKDLSVFEVDGNMSKIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVLTKNDEKGCHLV
GYFSKEKLCQQKYNVSCIMIMPQHQRQGFGRFLIDFSYLLSRREGQAGSPEKPLSDLGRL
SYLAYWKSVILEYLYHHHERHISIKAISRATGMCPHDIATTLQHLHMIDKRDGRFVIIRR
EKLILSHMEKLKTCSRANELDPDSLRWTPILISNAAVSEEEREAEKEAERLMEQASCWEK
EEQEVLSTRANSRQSPAKVQSKNKYLHSPESRPVTGERGQLLELSKESSEEEEEEEEDEE
EEDEEEEEEEEEDEEEEEEEEEEEEEEEEENIQSSPPRLTKPQSVAIKRKRPFVLKKKRG
RKRRRINSSVTTETISETTEVLNEPFDNSDEERPMPQLEPTCEIEVEEDGRKPVLRKAFQ
HQPGKKRQTEEEEGKDNHCFKNADPCRNNMNDDSRNLKEGSKDNPEPLKCKQAWPKGTKR
GLSKWRQNKERKTGFKLNLYTPPETPLEPDEQVTVEEQKETSEGKTSPTPISIEEEAKEA
GEALLPQEENRRQETCAPVSPNTSPGEKPEDDLIKPEEEEEEEEEEEEEEGEEEEEEEGG
NVEKDPDGAKSQEKEEPEISPEKEDSARLDDHEEEEEEDEEPSHNEDHDADDEDDSHMES
AEVEKEELPRESFKEVLENEEAFLDLNVQPSHSNPEVLMDCGVDLTASCNSEPKELAGDP
EAVPESDEEPPPGEQAQKQDQKNSKEVDTEFKEGNPATMEIDSETVQAVQSLTQESSEQD
DTFQDCAETQEACRSLQNYTRADQSPQIATTLDDCQQSDHSSPVSSVHSHPGQSVRSVNS
PSVPALENSYAQISPDQSAISVPSLQNMETSPMMDVPSVSDHSQQVVDSGFSDLGSIEST
TENYENPSSYDSTMGGSICGNGSSQNSCSYSNLTSSSLTQSSCAVTQQMSNISGSCSMLQ
QTSISSPPTCSVKSPQGCVVERPPSSSQQLAQCSMAANFTPPMQLAEIPETGNANIGLYE
RMGQSDFGAGHYPQPSATFSLAKLQQLTNTLIDHSLPYSHSAAVTSYANSASLSTPLSNT
GLVQLSQSPHSVPGGPQAQATMTPPPNLTPPPMNLPPPLLQRNMAASNIGISHSQRLQTQ
IASKGHVSMRTKSASLSPAAATHQSQIYGRSQTVAMQGPARTLTMQRGMNMSVNLMPAPA
YNVNSVNMNMNTLNAMNGYSMSQPMMNSGYHSNHGYMNQTPQYPMQMQMGMMGTQPYAQQ
PMQTPPHGNMMYTAPGHHGYMNTGMSKQSLNGSYMRR
NT seq 6234 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaacttgcaaacccactttatacagagtggattcttgaagctatacagaaaata
aaaaagcaaaagcaaaggccctctgaagagagaatctgccatgcggtcagtacttcccat
gggttggataagaagacagtctctgaacagctggaactcagtgttcaggatggctcagtt
ctcaaagtcaccaacaaaggccttgcctcctataaggacccagacaaccctgggcgcttt
tcatcagttaaaccaggcacttttcctaagtcaaccaaggggtctagaggatcatgtaac
gatctccgcaatgtggattggaataaacttttaaggagagcaattgaaggacttgaggag
ccaaatggctcctccctgaagaacatagagaagtatctcagaagtcaaagtgatctcacg
agcaccaccaacaacccagcctttcagcagcggctgcgactgggggccaaacgcgctgtg
aataatgggaggttactgaaagatggaccgcagtacagggtcaattatgggagcttagat
ggcaaaggggcacctcagtatcccagtgctttcccatcctcgctcccacctgtcagcctt
ctaccccatgagaaagaccagccacgtgctgatcccattccaatatgtagcttctgtttg
gggactaaagaatcaaatcgtgaaaagaaaccagaagaactcctctcttgtgcagattgt
ggcagtagtggacacccatcctgtttgaaattttgtcctgaattaacaacaaatgtaaag
gccttaaggtggcagtgcatcgaatgcaagacatgcagtgcctgtagagtccaaggcaga
aatgctgataatatgcttttttgtgattcctgtgatagaggattccatatggaatgctgt
gacccaccactttccagaatgccaaaagggatgtggatttgccaagtctgcagaccaaag
aaaaagggaagaaaactacttcatgagaaagctgcacaaataaaacgacgatatgcaaaa
cccattggacgaccgaaaaataaattaaagcaacgattgttgtctgtaaccagtgatgaa
ggatccatgaatgcattcacaggaagggggtcacctggtaggggtcaaaagactaaagtc
tgtaccacaccttcatctggtcatgctgcatctgggaaggactcaagcagcagattggct
gttacagaccccactcggcctggtgccaccaccaaaatcaccaccacctccacctacatt
tctgcctctacacttaaagttaacaagaaaaccaaagggctcattgatggccttactaag
ttttttacaccatcacctgatggtcgcagatcacgaggtgaaataatagacttttcaaag
cactatcgtccaaggaaaaaggtctctcagaaacagtcatgcacttctcatgtgttggct
acaggtaccacacaaaagctaaaacctccaccttcttcacttccacccccaacccccatc
tccggtcagagccccagttcacaaaagtccagcacggccacttcttctccctctccccag
agttcttccagccagtgcagcgtgccctccctgagcggcctgaccactaacagccagctg
aaggcactctttgatgggctctctcatatctataccactcagggacagtctcgcaaaaag
ggacacccaagttatgcaccacccaaacgtatgcgtcgtaaaactgaattgtcttccacg
gcaaaatctaaagcccacttctttggcaaaagagatattagaagtcggtttatttctcac
tcctcctcctctagctgggggatggctagaggacgtatttttaaagcaattgctcacttc
aagcgaacaaccttccttaaaaagcacaggatgctaggcagattaaaatataaagtgacc
cctcagatggggaccccctcaccagggaaggggagcttgacagacggaaggattaaacct
gatcaggatgatgatactgaaataaaaataaacatcaaacaagaaagtgcagatgtaaat
gtgattggaaacaaggatgtcgttactgaagaggatttggatgtttttaagcaggcccag
gaactttcttgggagaaaatagagtgtgagagtggggtggaagactgtggccggtaccct
tctgtgattgaatttggtaaatacgaaatccaaacctggtactcctcgccttacccacag
gaatatgcaagattaccaaagctttacctgtgtgaattctgtcttaaatatatgaaaagt
aaaaatattttgctaagacactccaagaagtgcggatggtttcatcctccagcaaatgaa
atttaccggaggaaagacctttcagtatttgaggttgatgggaatatgagcaaaatttat
tgccaaaacctttgcttgttagccaagctcttcctggaccacaaaacgttgtattatgat
gtcgagccattccttttttatgtccttacaaaaaatgatgaaaagggctgtcatctggtt
ggatacttctctaaggaaaagctttgccagcagaagtataatgtctcctgcataatgatc
atgccccagcaccaaaggcaaggatttggacggtttctcattgatttcagctatttgctt
tctagaagagaaggccaagcagggtctcctgaaaagcctctctccgatctgggccgtctc
tcctacctggcatattggaagagcgtcatcttagagtatctctaccaccaccatgagagg
cacatcagcatcaaagcaattagcagagcgacgggcatgtgcccacatgacattgccacc
actctgcagcacctccacatgatcgacaagagagatggcagatttgtcatcattagacgg
gaaaagttgatactgagccacatggaaaagctgaaaacctgttccagagccaatgaactt
gatccagacagtctgaggtggaccccaattttaatttctaatgctgcagtgtctgaagaa
gagcgagaagctgagaaagaggctgagcggctaatggaacaagctagctgctgggagaag
gaggaacaagaagtcctgtcaactagagctaacagtaggcaatcacctgcaaaagtacaa
tcgaaaaataaatatttgcattccccggagagccggccagtcacaggggagcgagggcag
ctgctggagctctctaaagagagcagtgaagaagaagaggaggaggaggaggacgaggag
gaggaggacgaggaggaagaggaggaggaggaagaggacgaagaggaggaagaagaggaa
gaagaagaggaagaagaagaagaagaagaaaatattcaaagctctcccccgagattgacg
aaaccacagtcagttgccataaagagaaagaggccttttgtactaaagaagaaaaggggt
cgtaaacgcaggaggatcaacagcagtgtaacaacagagaccatttcagagacgacagaa
gtactgaatgagcccttcgacaactcagatgaagagaggccaatgccacagctggagcct
acctgcgagattgaagtggaggaagatggcaggaagccagtcttgagaaaagcattccaa
catcagcctgggaagaaaagacaaacagaggaagaggaaggaaaagacaatcattgcttt
aagaatgctgacccttgtagaaacaatatgaatgatgattcgaggaacttgaaagaaggc
agtaaagacaatcccgaacctctaaagtgcaaacaagcgtggccaaaaggaacaaagcgt
ggtctgtctaagtggaggcaaaacaaagagaggaagaccggatttaaactgaatttgtac
accccaccagaaacacccctggagcctgatgagcaggtaacagtggaagaacagaaggag
acttcagaaggaaaaaccagccccactcccatcagcattgaggaggaggccaaggaagct
ggggaagccctgctgcctcaagaggaaaacagaaggcaagaaacatgtgcccctgtaagt
ccaaatacatcaccaggtgaaaaaccagaagatgatctcatcaaacctgaggaagaggag
gaggaggaggaagaagaggaagaagaggaaggggaagaagaagaagaagaagaaggagga
aatgtagaaaaagatccagatggtgctaaaagccaagaaaaagaggaaccagaaatctcc
ccggaaaaagaagactctgcacgtttggatgatcatgaagaggaggaggaagaggacgaa
gagccatctcacaacgaggaccatgatgccgatgacgaggatgacagccacatggagtct
gccgaagtggagaaggaagagctgcccagagaaagctttaaagaagtactggaaaacgag
gaggcttttttagaccttaatgtgcagcctagtcactcgaacccagaggtcttaatggac
tgtggcgtcgacctgacagcctcttgtaacagtgagcccaaggagcttgctggggaccct
gaagccgtacccgaatctgacgaggagccacccccaggagaacaggcacagaagcaggac
caaaagaacagcaaagaagtcgatacagagttcaaagagggaaacccagcaaccatggaa
atcgactctgagaccgtccaggcagttcagtctttgacccaggagagcagtgaacaggat
gacacctttcaggattgtgccgagactcaagaggcctgtagaagcctacagaactacacc
cgtgcagaccaaagtccacagattgccaccactctggacgattgccaacagtcagaccac
agtagcccggtttcatccgtccactcccatcctggccagtccgtacgttctgtcaatagc
ccaagtgtccctgctttggaaaacagctatgcccaaatcagcccagatcaaagtgccatc
tcagtgccatctctgcagaacatggaaaccagtcccatgatggatgtcccatcagtttca
gatcattcacagcaagtcgtagacagtggatttagtgacctgggcagtatcgagagcaca
actgagaactacgaaaacccaagcagctacgattctactatgggaggcagcatctgtgga
aatggctcttcacagaacagctgctcctatagcaacctcacctccagcagtctgacacag
agcagctgtgctgtcacccagcagatgtccaacatcagcgggagctgcagcatgctgcag
caaaccagcatcagctcccctccgacctgcagtgtcaagtctcctcaaggctgtgtggtg
gagaggcctccgagcagcagccagcagctggctcagtgcagcatggctgctaacttcact
ccacccatgcagctggctgaaatccccgagacgggcaacgccaacattggcttatacgag
cgaatgggtcagagtgattttggggctgggcattacccacagccgtcagccaccttcagc
cttgccaaactgcagcagttaactaatacacttattgatcattcattgccttacagccat
tccgctgctgtgacttcctatgcaaacagtgcctctttgtccacaccattaagtaacaca
gggcttgttcagctttctcagtctccacactccgtccctgggggaccccaagcacaagct
accatgaccccaccccccaacctgactcctcctccaatgaatctgccgccgcctcttttg
caacgaaacatggctgcatcaaatattggcatctctcacagccaaagactgcaaacccag
attgccagcaagggccacgtctccatgagaaccaagtcagcgtctctgtcaccagccgct
gccacccatcagtcacaaatctatgggcgctcccagactgtagccatgcagggtcctgca
cggactttaacgatgcaaagaggcatgaacatgagtgtgaacctgatgccagccccagcc
tacaatgtcaactctgtgaacatgaacatgaacactctcaatgccatgaatgggtacagc
atgtcccagccaatgatgaacagtggctaccacagcaatcatggctatatgaatcaaacg
ccccaataccctatgcagatgcagatgggcatgatgggcacccagccatatgcccagcag
ccaatgcagacccccccccacggtaacatgatgtacacggcccctggacatcacggctac
atgaacacaggcatgtccaaacagtctctcaatggctcctacatgagaaggtag

DBGET integrated database retrieval system