KEGG   Macaca fascicularis (crab-eating macaque): 102128408Help
Entry
102128408         CDS       T02918                                 

Gene name
JOSD2
Definition
Josephin domain containing 2
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Brite
Enzymes [BR:mcf01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     102128408 (JOSD2)
Peptidases [BR:mcf01002]
 Cysteine Peptidases
  Family C86
   102128408 (JOSD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
19
AA seq 188 aa AA seqDB search
MSQAPGAQPSPPSVYHERQRLELCAVHALNNVLQQQLFSQEAADEICKRLAPDSRLNPHR
SLLGTGNYDVNVIMAALQGLGLAAVWWDRRRPLSQLALPQVLGLILNLPSPVSLGLLSLP
LRRRHWVALRQVDGIYYNLDSKLRAPEALGDEDGVRAFLATALAQGLCEVLLVVTKEVEE
KGCWLRTD
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgtcccaggccccgggagcacagccgagcccaccctctgtgtaccacgaacggcagcgc
ctggagctatgtgccgtccacgccctcaacaacgttctgcagcagcagctctttagccag
gaggctgccgatgagatctgcaagaggttggccccagactcccggctgaaccctcatcgc
agcctcctgggcaccggcaactatgacgtcaacgtgatcatggccgctctgcaggggctg
ggcctggccgccgtgtggtgggacaggaggaggcccctgtcccagctggccctgccccag
gtgctgggactaatcctgaacctgccctcgcccgtgtctctggggctgctgtcactgccg
ctacgccggcggcactgggtggccctgcgccaggtggacggcatctactacaacctggac
tccaagctgcgggcgcccgaggccctgggggacgaggacggagtcagggccttcctggcg
actgcgctggcccagggcctgtgtgaggtgctgctggtggtgaccaaggaggtggaggag
aagggctgctggcttcggacagactga

DBGET integrated database retrieval system