KEGG   Macaca fascicularis (crab-eating macaque): 102128556Help
Entry
102128556         CDS       T02918                                 

Definition
liver carboxylesterase 1-like
Orthology
K01044  
carboxylesterase 1 [EC:3.1.1.1]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
Drug metabolism - other enzymes
Metabolic pathways
Class
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - other enzymes [PATH:mcf00983]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
20
AA seq 566 aa AA seqDB search
MWLRALVLGTLAASTVWAGHPSLPPVVDTVHGKVLGKFVSLEGFAQPVAVFLGIPFAKPP
LGPLRFTPPQPAEPWSFVKNATSYPPMCIQDPKAGQFLSDLLSNRKENISLKVSEDCLYL
NIYTPADLTKKNRLPVMVWIFGGGLVVGAASTYDGKVLAAHENVVVVTIQHRLGILGFFS
TGDEHSRGNWGHLDQLAALRWVQDNIASFGGNPGSVTIFGESSGGESVSVLIFSPLSKNL
FHRAISESGVALTHALLEDGDIKPLAEKIANTAGCQTTTSAVMVQCLRQKTEEELLETTS
KMKFLTLQLHGDPRKSYPHTPTVIDGVVLPKTPEELQAERKFLTVPYIIGINKKEFGWFL
PTLMGYPLSEGKLDQKTAMSLLWKSYPLVHIPKELIPEATEKYLGGTDDPVKKKDLFLDL
MGDVMFGVPSVIVARHHRDAGAPTYMYEFQYRPSFSSDMKPKTVIGDHGDELFSVLGAPF
LKEGASEEEIRLSKMMMKFWANFARSGNPNGEGLPHWPEYDQKEGYLQIGANTQVAQKLK
DKEVVFWTNLFKKAAEQPPQTEHIEL
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgtggctccgcgctcttgtcctgggcactctcgctgcttccacggtttgggcagggcac
ccgtccttgccacctgtggtggacaccgtgcatggcaaagtgctggggaagttcgtcagc
ttagaaggatttgcacagcctgtggccgttttcctgggaatcccttttgccaagccccct
cttggacccctgaggtttactccaccgcagcctgcagagccatggagcttcgtgaagaat
gccacctcttaccctcctatgtgcatccaagatcccaaggcggggcagtttctctcagac
ctattgagtaacagaaaggagaacatttctctcaaggtttccgaagactgtctttacctc
aatatttacactcctgctgacttgaccaagaaaaacaggctgccggtgatggtgtggatc
ttcggagggggactggtggtgggtgcagcatcaacctatgatgggaaggtcctcgctgcc
cacgaaaacgtggtggtggtgaccattcagcaccgcctgggcatcttgggattcttcagc
acaggggatgaacacagccgggggaactggggccacctggaccagctggctgccctgcgt
tgggtccaggacaacattgccagctttggagggaacccaggctctgtgaccatctttgga
gagtcatcgggaggagaaagtgtctctgttcttattttctctccattgtccaagaatctc
ttccaccgggccatttctgagagtggtgtggccctcactcatgctctgttggaggacggt
gacatcaagcccctggctgagaaaattgctaacactgctgggtgtcaaaccaccacctca
gctgtcatggttcagtgtctgcgacagaagacggaagaggagctcttggagacgacatcg
aaaatgaaattcttaactctgcagttacatggagaccccagaaagagttacccccacacg
cccaccgtgattgatggagtggtgctgccaaaaacacctgaggagcttcaagctgaaagg
aagttcctcactgtcccctacatcatcggaattaacaagaaggaatttggctggtttctt
ccaacgttgatgggctatccactctccgaagggaaactggaccagaagacagccatgtca
ctcttgtggaagtcctatccccttgttcacattcctaaggaactgattccagaagccact
gagaagtacttaggaggaacagatgaccctgtcaaaaagaaagacctgttcctggactta
atgggggatgtaatgttcggtgtcccatctgtgattgtggcccggcaccacagagatgct
ggagcacccacctacatgtatgagtttcagtatcgtccaagcttctcatcagacatgaaa
cccaagacggtgataggagaccacggggatgagctcttctccgtccttggggccccattt
ttaaaagagggtgcctcagaagaggagatcagactcagcaagatgatgatgaaattctgg
gctaactttgctcgcagtggaaaccccaatggggaagggctgccccactggccagagtac
gaccagaaggaagggtacctgcagattggtgccaacacccaggtggcccagaagctgaag
gacaaggaagtggttttctggaccaacctctttaagaaggcagcggagcagccaccccag
acagaacacattgagctgtga

DBGET integrated database retrieval system