KEGG   Macaca fascicularis (crab-eating macaque): 102128580Help
Entry
102128580         CDS       T02918                                 

Gene name
UGT2B20
Definition
UDP-glucuronosyltransferase 2B20-like (EC:2.4.1.17)
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Chemical carcinogenesis
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:mcf00040]
Metabolism; Carbohydrate metabolism; Ascorbate and aldarate metabolism [PATH:mcf00053]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mcf00500]
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:mcf00140]
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:mcf00830]
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:mcf00860]
Metabolism; Xenobiotics biodegradation and metabolism; Metabolism of xenobiotics by cytochrome P450 [PATH:mcf00980]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - cytochrome P450 [PATH:mcf00982]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - other enzymes [PATH:mcf00983]
Human Diseases; Cancers; Chemical carcinogenesis [PATH:mcf05204]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 530 aa AA seqDB search
MSLKWTSVFLLLQLSCYFSSGSCGKVLVWPTEYSHWINMKTILEELVRRRHEVTVLTSSA
STFVNDSKSSAIKFEVYPTSLTKNDMEDSLMKLLDIWTYSISNSTFLSYFSKLQELCWEY
YYYSEKLCKDAVLNKKLMTKLKETKFDVILADALNPCGELLAELFNIPFVYSLRFTVGYT
FEKNGGGFLFPPSYVPVVMSELSDQMTFTERIKNMIHKLYFDFWFQIHDIKKWDQFYSEV
LGRPTTLFETMRKAEMWLIRTYWDFEFPRPFLPNVDFVGGLHCKPAKPLPKEMEEFVQSS
GENGVVVFSLGSMISNMSEERANMIASALAQIPQKVLWKFDGKKPNTLGSNTRLYKWLPQ
NDLLGHPKTKAFITHGGTNGIYEAIYHGIPMVGIPLFADQHDNIVHMKVKGAALSVDIRT
MSSRDLLNALKSVINEPIYKENAMKLSRIHHDQPMKPLDRAVFWIEFVMRHKGAKHLRVA
AHNLTWIQYHSLDVIAFLLACVAAVIFIITKCCLFCFRKLAKTGKKKKWD
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgtctctgaaatggacgtcagtctttctgctgttacaactcagttgttattttagctct
gggagttgtggaaaggtgctggtgtggcccacagaatacagccattggataaatatgaag
acaatcctggaagagcttgttcggagacgtcatgaggtgactgtgttgacatcctcggct
tctacttttgtcaatgacagtaaatcatctgctattaaatttgaagtttatcctacatct
ttaactaaaaatgatatggaagattctcttatgaaactgctagatatttggacatatagt
atttcaaacagtacatttttgtcgtatttttccaaactacaagaattgtgttgggaatat
tattactatagtgaaaagctctgtaaagatgcagttttgaacaagaaacttatgacaaaa
ctaaaagagacaaagtttgatgtcattctggcagatgcccttaatccctgtggggagcta
ctggctgagctatttaacataccctttgtgtacagcctccgcttcactgttggctacaca
tttgagaagaatggtggaggatttctgttccctccttcctatgtacctgttgttatgtca
gaattaagtgatcaaatgactttcacagagaggataaaaaatatgatacataagctttat
tttgacttttggtttcaaatacatgatataaagaagtgggaccagttttacagtgaagtt
ctaggaagacccactacattatttgagacaatgaggaaagctgaaatgtggctcattcga
acctattgggattttgaatttcctcgcccattcttaccaaatgttgattttgttggagga
cttcactgtaaaccagccaaacccctgcctaaggaaatggaagagtttgtccagagctct
ggagaaaatggtgttgtggtgttttctctggggtcgatgatcagtaacatgtcagaagaa
agggccaacatgattgcatcagcccttgcccagatccctcaaaaggttctatggaaattt
gatggcaagaagccaaatactttaggctccaatactcgactgtacaagtggttaccccag
aatgaccttcttggtcatcccaaaaccaaagcttttataactcacggtggaaccaatggc
atctatgaggcgatctaccatgggatccctatggtgggcattcccttgtttgcggatcaa
catgataacattgttcacatgaaagtcaagggagcagccctcagtgtggacatcaggacc
atgtcaagtagagatttgctcaatgcattgaagtcagtcattaatgagcctatctataaa
gagaatgccatgaaattatcaagaattcatcatgatcaaccaatgaaacccctggatcga
gcagtcttctggattgagtttgttatgcgccacaaaggagccaagcaccttcgggtcgca
gctcacaacctcacctggatccagtaccactctttggatgtgatagcattcctgctggcc
tgcgtggcagctgtgatatttatcatcacaaaatgttgcctgttttgcttccgaaagctt
gccaaaacaggaaagaagaagaaatgggattag

DBGET integrated database retrieval system