KEGG   Macaca fascicularis (crab-eating macaque): 102128631Help
Entry
102128631         CDS       T02918                                 

Gene name
PADI2
Definition
peptidyl arginine deiminase, type II
Orthology
K01481  
protein-arginine deiminase [EC:3.5.3.15]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Brite
Enzymes [BR:mcf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.15  protein-arginine deiminase
     102128631 (PADI2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 687 aa AA seqDB search
MLRERTVRLQYGSRVEAVYVLGTYLWTDVYSAAPAGAQTFSLKHSERVRVEVVRNGEAEE
VATNGKQRWLLSPSTTLRVTMNQASTEASSDKVTVNYYDEEGSIPIDQAGLFLTAIEISL
DVDADRDGVVEKNNPKKASWTWGPEGQGAILLVNCDRETPWLPKEDCRDEKVYSKEDLKD
MSQMILRTKGPDRLPAGYEMVLYISMSDSDKVGVFYVETLQGIKKFLLELRRVLSPCLYQ
YPFFGQRYIHILGRRKLYHVVKYTGGSAELLFFVEGLCFPDEGFSGLVSIHVSLLEYMAQ
DIPLTPIFTDTVIFRIAPWIMTPNILPPVSVFVCCMKDNYLFLKEVKNLVEKTNCDLKVC
FQYINRGDRWIQDEIEFGYIEAPHKGFPVVLDSPRDGNLKDFPVKELLGPDFGYVTREPL
FEPVTSLDSFGNLEVSPPVTVNGKTYPLGRILIGSSFPLSGGRRMTKVVRDFLKAQQVQA
PVELYSDWLTVGHVDEFMSFVPIPGTKKFLLLMASTSACYKLFREKQKDGHGEAIMFKGL
GGMSSKRITINKILSNESLVQENLYFQRCLDWNRDILKKELGLTEQDIIDLPALFKMDKD
HRARAFFPNMVNMIVLDKDLGIPKPFGPQVEEECCLEMHVRGLLEPLGLECTFIDDISAY
HKFLGEVHCGTNVRRKPFTFKWWHMVP
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgcgagcggaccgtgcggctgcagtacgggagccgcgtggaggcggtgtacgtg
ctgggcacctacctctggaccgatgtctacagcgcggccccagctggggcccaaaccttc
agcctgaagcactcggaacgcgtgcgggtagaggtggtgcgcaatggggaggccgaggag
gtggccaccaatggcaagcaacgctggcttctctcgcccagcaccaccctgcgggtcacc
atgaaccaggcgagcaccgaggccagcagtgacaaggtcaccgtcaactactacgatgag
gaaggcagcattcccattgaccaggcggggctgttcctcacggccattgagatctccctg
gatgtggacgcagaccgggatggcgtggtggagaagaacaacccaaagaaggcatcctgg
acctggggccccgagggccagggggccatcctgctggtgaactgcgaccgagagacaccc
tggttgcccaaggaggactgccgtgacgagaaggtctacagcaaggaagatctcaaggac
atgtcccagatgatcctgcggaccaaaggccccgaccgcctccccgccggatacgagatg
gttctgtacatttccatgtcagactcagacaaagtgggcgtgttctacgtggagactcta
cagggcataaagaaattccttctggaactgcgtagggtcctatctccatgcctttaccaa
tacccgttcttcggccaacgctatatccacatcctgggccggcggaagctctaccatgtg
gtcaagtacacgggtggctccgcggagctgctcttcttcgtagaaggcctctgtttcccc
gacgagggcttctcaggcctggtctccatccatgtcagcctgctggagtacatggcccag
gacattcccctgacacccatcttcacggacaccgtgatattccgaattgctccgtggatc
atgacccccaacatcctgcctcctgtgtcggtgtttgtatgctgcatgaaggataattac
ctgttcctgaaagaggtgaagaacctggtggagaaaaccaactgtgacctgaaggtctgc
ttccagtacataaaccgaggcgatcgctggatccaggatgagattgagtttggctacatc
gaggccccccacaaaggcttccccgtggtgctggactccccccgagatggaaacctaaag
gactttcctgtgaaggagctcctgggcccagattttggctacgtgacccgggagcccctc
tttgagcctgtcaccagccttgactcgtttggaaacctggaggtcagtcccccagtgacc
gtgaacggcaagacataccctcttggccgcatcctcatcgggagcagctttcctctgtct
ggtggtcggaggatgaccaaggtggtgcgtgacttcctgaaggcccagcaggtgcaggcg
cccgtggagctctactcggactggctgactgtgggccacgtggatgagttcatgtccttt
gtccccatccctggcacaaagaaattcctgctgcttatggccagcacctcggcctgctac
aagctcttccgagagaagcagaaggacggccatggagaggccatcatgttcaaaggcttg
ggtgggatgagcagcaaacgaatcaccatcaacaagattctgtccaacgagagcctcgtg
caggagaacctgtactttcagcgctgcctggactggaaccgtgacatcctcaagaaggag
ctgggactgacagagcaggacatcattgacctgcccgctctgttcaagatggacaaggac
caccgtgccagagccttcttcccaaacatggtgaacatgatcgtgctggacaaggacctg
ggcatccccaagccattcgggccacaggtggaggaggagtgctgcctggagatgcacgtg
cgcggcctcctggagcctctgggcctcgaatgcaccttcatcgacgacatttctgcctac
cacaagtttctgggggaagtccactgcggcaccaacgtccgcaggaagccctttaccttc
aagtggtggcacatggtaccctga

DBGET integrated database retrieval system