KEGG   Macaca fascicularis (crab-eating macaque): 102129758Help
Entry
102129758         CDS       T02918                                 

Gene name
LPL
Definition
(RefSeq) lipoprotein lipase
  KO
K01059  
lipoprotein lipase [EC:3.1.1.34]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
Glycerolipid metabolism
PPAR signaling pathway
Cholesterol metabolism
Alzheimer's disease
Brite
KEGG Orthology (KO) [BR:mcf00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    102129758 (LPL)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    102129758 (LPL)
  Digestive system
   04979 Cholesterol metabolism
    102129758 (LPL)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    102129758 (LPL)
Enzymes [BR:mcf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.34  lipoprotein lipase
     102129758 (LPL)
Exosome [BR:mcf04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   102129758 (LPL)
  Exosomal proteins of breast milk
   102129758 (LPL)
Glycosaminoglycan binding proteins [BR:mcf00536]
 Heparan sulfate/Haparin
  Enzymes (General comment) Variety
   102129758 (LPL)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcf00537]
 Enzymes
  102129758 (LPL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
8
AA seq 475 aa AA seqDB search
MESKALLLLALAVWLQSLTASRGGVAAADQRRDFIDIESKFALRTPEDTAEDTCHLIPGV
AESVATCHFNHSSKTFMVIHGWTVTGMYESWVPKLVAALYKREPDSNVIVVDWLSRAQQH
YPVSAGYTKLVGQDVARFINWMEEEFNYPLDNVHLLGYSLGAHAAGIAGSLTNKKVNRIT
GLDPAGPNFEYAEAPSRLSPDDADFVDVLHTFTRGSPGRSIGIQKPVGHVDIYPNGGTFQ
PGCNIGEAIRVIAERGLGDVDQLVKCSHERSIHLFIDSLLNEENPSKAYRCSSKEAFEKG
LCLSCRKNRCNNLGYEINKVRAKRSSKMYLKTRSQMPYKVFHYQVKIHFSGTERETHTNQ
AFEISLYGTVAESENIPFTLPEVSTNKTYSFLIYTEVDIGELLMLKLKWKSDSYFSWSDW
WSSPGFAIQKIRVKAGETQKKVIFCSREKVSHLQKGKAPAVFVKCHDKSLNKKSG
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atggagagcaaagccctgctcctgctggccctggccgtgtggctccagagtctgaccgcc
tcccgcggaggggtggccgccgccgaccaaagaagagattttatcgacatcgaaagtaaa
tttgccctaaggacccctgaagacacagctgaggacacttgccacctcattcctggagta
gcagagtctgtggcgacctgtcacttcaatcacagcagcaaaaccttcatggtgatccac
ggctggacggtaacaggaatgtatgagagttgggtgccaaaacttgtggccgccctgtac
aagagagaaccagactccaacgtcattgtggtggactggctgtcacgggctcagcagcat
tacccagtgtccgcaggctacaccaaactggtgggacaggacgtggcccggtttatcaac
tggatggaggaggagtttaactaccctctggacaatgtccatctcttgggatacagcctc
ggagcccatgctgctggcattgcaggaagtctgaccaataagaaagtcaacagaattact
ggccttgatccagctggacctaactttgagtatgcagaggccccgagtcgcctttctcct
gatgatgcagattttgtagacgtcttacacacattcaccagagggtcccctggccgaagc
attggaatccagaaaccagttgggcatgttgacatttacccgaatggaggtacttttcag
ccaggatgtaacattggagaagctattcgcgtgattgcagagagaggccttggagatgtg
gaccagctagtgaagtgctcccacgagcgctccattcatctcttcatcgactccttgttg
aatgaagaaaatccaagtaaggcctacaggtgcagttccaaggaagcctttgagaaaggg
ctctgcttgagttgtagaaagaaccgctgcaacaatctgggctatgagatcaataaagtc
agagccaaaagaagcagcaagatgtacctgaagactcgttctcagatgccctacaaagtc
ttccattaccaagtaaagattcatttttctgggactgagagggaaacccataccaaccag
gcctttgagatttctctgtacggcaccgtggctgagagtgagaacatcccattcaccctg
cctgaagtttccacaaataagacatactccttcctaatttacacagaagtagacattgga
gaactactcatgttgaagctcaaatggaagagcgattcatacttcagctggtcagactgg
tggagcagtcccggctttgccattcagaagatcagagtaaaagccggagagactcagaaa
aaggtgatcttctgttctagggagaaagtgtctcacttgcaaaaaggaaaggcacctgcg
gtatttgtgaaatgccatgacaagtctctgaataagaagtcaggctga

DBGET integrated database retrieval system