KEGG   Macaca fascicularis (crab-eating macaque): 102129802Help
Entry
102129802         CDS       T02918                                 

Gene name
CES5A
Definition
carboxylesterase 5A
Orthology
K15743  
carboxylesterase 3/5 [EC:3.1.1.1]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Brite
Enzymes [BR:mcf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     102129802 (CES5A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
20
AA seq 610 aa AA seqDB search
MAVLVCPAPCHVLKEFRIRRGMWRLCLVHYFYPTSSTLYVLNIDVLNHSSKDERPSAEGP
QRNTRLGWIQGKQVTVLGSPVPVNVFLGVPFAAPPLGPLRFTNPQPASPWDNLREATSYP
NLCLQNSEWLRLDQHMLKVHYPNIGASEDCLYLNIYAPAHADAGSKLPVLVWFPGGAFKT
GSASIFDGSALAAYEDVLVVVIQYRLGIFGFFTTWDQHAPGNWAFKDQVAALSWVQKNIE
FFGGDPSSVTIFGESAGAISVSSLILSPMAEGLFHKAIMESGVAIIPYLKAHDYEKSEDL
QVVAHFCGKNASDSEDLLRCLRTKSSKELLTLSQKAKSFTRVVDGAFFPNEPLDLLSQKA
FKAIPSIIGVNNHECGFLLPMKEAPEILSGSNKSLALHLIQNILHIPPQYLHLVANEYFH
DKHSLTEIRDGLLDLLGDVFFVVPALITARYHRDAGAPVYFYEFRHRPQCFEDTKPAFVK
ADHADEVRFVFGGAFLKGDIVMFEGATEEEKLLSRKMMKYWATFARTGNPNGDDLPLWPA
YNLTEQYLQLDLNMSLGQRLKEPRVEFWTSTIPLILSASDTLHSPLSVLIFLSLLQPFFF
SCVPWEVIFP
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atggccgttctggtttgccctgctccatgccatgtcctaaaggagtttaggataagaagg
ggaatgtggagattgtgcctggttcactatttttatccaacctcctcaactttgtatgta
ttgaatattgatgttttaaaccacagttccaaagatgagaggccttctgctgaagggcca
cagaggaacaccaggctgggatggattcagggcaagcaagtcactgtgctgggaagccct
gtgcctgtgaacgtgttcctcggagtcccctttgctgctcccccgctgggacccctgcga
tttacgaaccctcagcctgcatcgccctgggataacttgcgagaagccacctcctaccct
aatttgtgcctccagaactcagagtggctgcgcttagatcaacacatgctcaaggtgcat
taccccaatattggcgcgtcagaagactgcctgtacctgaacatctatgcgcctgcccac
gccgatgcaggctccaagctccccgtcttggtgtggttcccagggggtgccttcaagact
ggctcagcctccatcttcgatgggtccgctctggctgcctatgaggacgtgctggttgtg
gtcatccagtaccggctgggaatatttggcttcttcaccacatgggatcagcacgcgccg
gggaactgggccttcaaggaccaggtggctgctctgtcctgggtccagaagaacatcgag
ttctttggtggggaccccagctctgtgaccatctttggcgagtccgcgggagccataagt
gtttcaagccttatactgtctcccatggccgaaggcttattccacaaagccatcatggag
agtggggtggccatcatcccttacctgaaggcccatgactatgagaagagtgaggacctg
caggtggttgcacatttctgtgggaagaatgcatcagactctgaggacctgctgaggtgc
ctgaggacaaaatcctccaaggagctgctgaccctcagccagaaagcaaagtctttcact
cgagtggttgatggtgctttctttcctaatgagcctctagatctattgtctcagaaagca
tttaaagcaattccttccatcatcggagtcaataaccatgagtgtggcttcctgctgcct
atgaaggaggctcctgagatcctcagtggctccaacaagtcccttgccctccatctgata
caaaacatcctgcacatcccgcctcagtatttgcaccttgtggctaatgaatacttccat
gacaagcactccctgactgaaatccgagacggtcttctggacttgcttggagatgtgttc
tttgtggtccctgcactgatcacagctcgatatcaccgagatgctggtgcacctgtctac
ttctatgagtttcggcaccggccccagtgctttgaagacacgaagccagcttttgtcaaa
gccgaccacgctgatgaagtccgctttgtgttcggtggtgccttcctgaagggtgacatt
gttatgttcgaaggagccacggaggaggagaagttgctgagccggaagatgatgaaatac
tgggctacctttgctcgaactgggaatcccaatggggacgacctgcctctgtggccagcc
tataatctgaccgagcagtacctgcagctggacttgaacatgagcctcggacagagactc
aaagaaccgcgggtggagttttggaccagcaccatccccctgatcctgtctgcctccgac
acgctccatagtcctctttccgtcttaattttcctctctctcctccagcctttctttttc
tcttgtgttccttgggaagttatctttccgtga

DBGET integrated database retrieval system