KEGG   Macaca fascicularis (crab-eating macaque): 102129898Help
Entry
102129898         CDS       T02918                                 

Gene name
GPT
Definition
glutamic-pyruvate transaminase (alanine aminotransferase)
Orthology
K00814  
alanine transaminase [EC:2.6.1.2]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:mcf01200]
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:mcf01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:mcf01230]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:mcf00250]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
8
AA seq 512 aa AA seqDB search
MRVPRGLGLGQALLGVMASSTGDQSQAVRNGLRTKVLTLHSMNPRVRQVEYAVRGPIVQR
ALELEQELRQGVKKPFTEVIRANIGDAQAMGQRPITFLRQVLALCVNPDLLTSPSFPDDA
KKRAERILQACGGHSLGAYSVSSGIQLIREDVAQYIERRDGGIPADPNNVFLSTGASDAI
VTVLKLLVAGEGHTRTGVLIPIPQYPLYSATLAELGAVQVDYYLDEERAWALDVSELHRA
LCQARGHCHPRALCVINPGNPTGQVQTRECIEAVIRFAFEERLFLLADEVYQDNVYAAGS
QFHSFKKVLMEMGPPYAGQQELASFHSTSKGYMGECGFRGGYVEVVNMDAAVQQQMLKLM
SVRLCPPVPGQALLDLVVSPPAPTDPSFAQFQAERQAVLAELAAKAKLTEQVFNEAPGIS
CNPVQGAMYSFPRVQLPPRAVERAQELGLAPDMFFCLRLLEETGICVVPGSGFGQREGTY
HFRMTILPPLEKLRLLLEKLSRFHAKFTLEYS
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgcgggtgccacgagggctaggccttggccaagccctgctgggagtcatggcctcgagc
acaggtgaccagagccaggcagtgaggaacggactgagaacgaaggtgctgacgctgcac
agcatgaatccgcgtgtgcggcaagtggagtacgcagtgcgtggccccatagtgcagcga
gccttggagctggagcaggagctgcgccagggtgtgaagaagcctttcaccgaggtcatc
cgtgccaacatcggggacgcacaggctatggggcagaggcccatcaccttcctgcgccag
gtcctggctctctgtgtcaaccccgatcttctgaccagccccagcttccctgacgatgcc
aagaagagggcggagcgcatcctgcaggcgtgtgggggccacagcctgggggcctacagc
gtcagctctggcatccagctgatccgggaggacgtggcgcagtacatcgagaggcgcgac
ggaggtatccctgcggaccccaacaatgtcttcctgtccacaggggccagcgacgccatc
gtgacggtgctgaagctgctggtggccggcgagggccacacacgcacaggtgtgctcatt
cctatcccccagtacccactctactcggccacactggcagagctgggcgcagtgcaggtg
gattactacctggacgaggaacgcgcctgggcgttggacgtgtccgagcttcaccgtgca
ctgtgtcaggcgcgtggccactgccaccctcgtgcgctgtgtgtcatcaaccctggcaac
cccaccgggcaggtgcagacccgcgagtgcatcgaggctgtgatccgcttcgccttcgaa
gagcggctctttctgctggcggacgaggtgtaccaggacaacgtgtatgccgcgggctcc
cagttccactcattcaagaaggtgctcatggagatggggccgccctatgccgggcagcag
gagctcgcctccttccactccacctccaagggctacatgggcgagtgcgggttccgcggc
ggctatgtggaggtggtgaacatggacgctgcagtgcagcagcagatgctgaagctgatg
agtgtgcggctgtgcccgccggtgccaggccaggccctgctggacctggtggtcagcccg
cccgcgcccactgacccctccttcgcgcagttccaggctgagaggcaggcagtgctggcg
gagctggcggccaaagccaagctcactgagcaggtcttcaacgaggctcccggcatcagc
tgcaacccagtgcagggcgccatgtactccttcccgcgtgtgcagctgcccccgcgggcg
gtggagcgtgctcaggagctgggcctggcccccgacatgttcttctgcctgcgcctcctg
gaggagaccggcatctgcgtggtgcctgggagcggctttgggcagcgggaaggcacctac
cacttccggatgaccattctgccccccttggagaaactgcggctgctgctggagaagctg
agcagatttcatgccaaattcaccctcgagtactcctga

DBGET integrated database retrieval system