KEGG   Macaca fascicularis (crab-eating macaque): 102132033Help
Entry
102132033         CDS       T02918                                 

Gene name
SCD5
Definition
stearoyl-CoA desaturase 5
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
PPAR signaling pathway
Class
Metabolism; Overview; Fatty acid metabolism [PATH:mcf01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:mcf01040]
Organismal Systems; Endocrine system; PPAR signaling pathway [PATH:mcf03320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 330 aa AA seqDB search
MPGPATDAGKIPFCDAKEEIRAGLESSEGGGGPERPGARGQRQNIVWRNVVLMSLLHLGA
VYSLVLIPKAKPLTLLWAYFCFLLAALGVTAGAHRLWSHRSYKAKLPLRIFLAVANSMAF
QNDIFEWSRDHRAHHKYSETDADPHNARRGFFFSHIGWLFVRKHPDVIEKGRKLDVTDLL
ADPVVRIQRKYYKISVVLMCFAVPTLVPWYIWGESLWNSYFLASILRYTISLNVAWLVNS
AAHMYGNRPYDKHISPRQNPLVALGAIGEGFHNYHHTFPFDYSASEFGLNFNPTTWFIDL
MCWLGLATDRKRATKPMIEARKARTGDSSA
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgccaggcccggccaccgacgcggggaagatccccttctgcgacgccaaggaagaaatc
cgtgccgggctcgaaagctcggagggcggcggcggcccggagaggccaggcgcgcgcggg
cagcggcagaacatcgtctggaggaacgtcgtcctgatgagcctgctccacttgggggcc
gtgtactccctggtgctcatccccaaagccaagccgctcactctgctctgggcctacttc
tgcttcctcctggccgctctgggtgtgacagctggtgcccatcgcttgtggagccacagg
tcctacaaggccaagctgcctctgaggatatttctggctgtcgccaactccatggctttc
cagaatgacatcttcgagtggtccagggaccaccgagcccaccacaagtactcagagacg
gatgctgacccccacaatgcccgccggggcttcttcttctcccatatcgggtggctgttt
gttcgcaagcatccggatgttattgagaaggggagaaagcttgacgtcactgacctgctt
gctgatcctgtggtccggatccagagaaagtactataagatctccgtggtgctcatgtgc
tttgcggtccccacgctggtgccctggtacatctggggagagagcctgtggaattcctac
ttcttggcctctattctccgctataccatctcactcaatgtcgcctggctagtcaacagc
gccgcccacatgtatggaaaccggccctatgacaagcacatcagccctcggcagaaccca
ctcgtcgctctgggtgccattggtgaaggcttccataattaccatcacacctttcccttt
gactactctgcgagtgaatttggcttaaattttaacccaaccacctggttcattgatctc
atgtgctggctggggctggccactgaccgcaaacgggcaaccaagccgatgatcgaggcc
cggaaggccaggactggagacagcagtgcttga

DBGET integrated database retrieval system