KEGG   Macaca fascicularis (crab-eating macaque): 102133043Help
Entry
102133043         CDS       T02918                                 

Gene name
UCHL1, UCH-L1
Definition
ubiquitin carboxyl-terminal esterase L1 (ubiquitin thiolesterase)
Orthology
K05611  
ubiquitin carboxyl-terminal hydrolase L1 [EC:3.4.19.12]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
Parkinson's disease
Brite
KEGG Orthology (KO) [BR:mcf00001]
 Human Diseases
  Neurodegenerative diseases
   05012 Parkinson's disease
    102133043 (UCHL1)
Enzymes [BR:mcf01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     102133043 (UCHL1)
Peptidases [BR:mcf01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   102133043 (UCHL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 223 aa AA seqDB search
MQLKPMEINPEMLNKVLSRLGVAGQWRFVDVLGLEEESLGSVPAPACALLLLFPLTAQHE
NFRKKQIEELKGQEVSPKVYFMKQTIGNSCGTIGLIHAVANNQDKLGFEDGSVLKQFLSE
TEKMSPEDRAKCFEKNEAIQAAHDAVAQEGQCRVDDKVNFHFILFNNVDGHLYELDGRMP
FPVNHGASSEGTLLQDAAKVCREFTEREQGEVRFSAVALCKAA
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgcagctcaagccgatggagatcaaccccgagatgctgaacaaagtgctgtcccggctg
ggggtcgccggccagtggcgcttcgtggacgtgctggggctggaagaggagtctctgggc
tcggtgccagcgcctgcctgcgcgctgctgctgctgtttccactcacggcccagcatgag
aacttcaggaaaaaacagattgaagagctgaagggacaagaagttagtcctaaagtgtac
ttcatgaagcagaccattgggaattcctgtggcacaatcggacttatacacgcagtggcc
aataatcaagataaactgggatttgaggatggatcagtcctgaaacagtttctttctgaa
acagagaaaatgtcccctgaagacagagcaaaatgctttgaaaagaatgaggccatacag
gcagcccatgatgccgtggcacaggaaggccaatgtcgggtagatgacaaggtgaatttc
catttcattctgtttaacaacgtggatggccacctctatgaactggatggacgaatgcct
tttccggtgaaccatggcgccagttcagagggcaccctgctgcaggacgctgccaaggtc
tgcagagaattcaccgagcgtgagcaaggagaagtccgcttctctgccgtggctctctgc
aaggcagcctaa

DBGET integrated database retrieval system