KEGG   Macaca fascicularis (crab-eating macaque): 102134146Help
Entry
102134146         CDS       T02918                                 

Gene name
TGM6
Definition
transglutaminase 6
Orthology
K05624  
transglutaminase 6 [EC:2.3.2.13]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Brite
Enzymes [BR:mcf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     102134146 (TGM6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
10
AA seq 706 aa AA seqDB search
MAGIRVTKVDWQRSRNGAAHHTQEYPCPELVVRRGQSFSLTLELSRAPDCEETFIFMVET
GPRASEALHTKAVFQTSELELGEGWTAAKEAQMENTLTVSLASPPNAVIGRYLLSIRLSS
HRKHSNRRLGEFVLLFNPWCAEDDVFLASEEERQEYVLNDSGIIFRGVEKHIRAQGWNYG
QFEEDILNICLSILDRSPGHQNNPATDVSCRHDPIYVTRVISAMVNSNNDRGVVQGQWQG
KYDGGTSPLHWRGSVAILQKWLKGRYKPVKYGQCWVFAGVMCTVLRCLGIATRVVSNFNS
AHDTDQNLSVDKYVDSFGRTLEDLTEDSMWNFHVWNESWFARQDLGPSYNGWQVLDATPQ
EESEGVFRCGPASVTAIREGDVHLAHDGPFVFAEVNADYITWLWHEDESRERVYSNTKKI
GRCISTKAVGSDSRVDITDLYKYPEGSRKERQVYSKAVKRLFSVKASGRRTWIRRAGGRC
LWHDDLLEPTTKPSITGKFKLLEPPMLGHDLRLALCLANLTSRVQQVRVNLSGATILYTR
KPVAEILHESHAVRLGRQEEKRIPITISYSKYKEDLTEDKKILLAAMCLVTKGEKLLVEK
DITLEDFITIKVLGPAMVGVAVTVEVTVVNPLLERVKDCALMVEGSGFLQEQLSIDVPTL
EPQERASVQFDITPSKSGPRQLQVDLVSPHFPDIKGFVIIHVATAK
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atggcagggatcagagtcaccaaggtggactggcagcggtcgaggaatggcgctgcccac
cacacccaggagtacccctgccctgagctggtggttcgcaggggccagtcgttcagcctc
acgctggagctgagcagagccccggactgcgaggagaccttcatcttcatggtggagaca
ggaccccgggcttctgaggccctccacaccaaagctgtgttccagacatcggagctggag
ctgggtgagggctggacagcagcaaaggaggctcagatggagaacactctgaccgtcagt
ctcgccagccctcccaatgctgtcattggccgctacctgctgagcatcaggctttcctct
caccgcaaacacagcaaccggaggctgggcgagtttgttcttcttttcaacccatggtgt
gcagaggacgatgtgtttctggcctcagaggaggagagacaggagtacgtgctcaacgac
agcggcatcatcttccgaggcgtggagaagcacatacgagcccagggctggaactacggg
cagtttgaggaggacatcctgaacatctgcctctccatcctggatcgaagccccggtcac
caaaacaacccagccaccgacgtgtcctgccgccacgaccccatctacgtcaccagggtc
atcagcgccatggtgaacagcaacaatgaccgaggtgtggtgcaaggacagtggcagggc
aagtacgacggcggcaccagcccgctgcactggcgtggcagcgtggccattctgcagaag
tggctcaagggcaggtacaagccagtcaagtacggccagtgctgggtcttcgcgggagtc
atgtgcacagtcctcaggtgcttggggatagccacacgggtcgtgtccaacttcaactca
gcccacgacacagaccagaacctgagtgtggacaaatacgtggactccttcgggcggacc
ctggaggacctgacagaagacagcatgtggaatttccatgtctggaatgagagctggttt
gcccggcaggacctaggcccctcttacaatggctggcaggttctggatgccaccccccag
gaggagagtgaaggtgtgttccggtgcggcccagcctcagtcactgccatccgcgagggt
gatgtgcacctggcccacgatggccccttcgtgtttgcggaggtcaacgctgactacatc
acctggctgtggcacgaggatgagagccgagagcgtgtatactcgaacacgaagaagatt
gggagatgcatcagcactaaggcggtaggcagcgactcccgtgtggacatcaccgacctc
tacaagtatccggaagggtcccggaaagagaggcaggtgtacagcaaggcggtgaagagg
ttgttcagcgtgaaagcctctggaaggagaacctggatccgcagggctggggggcgctgt
ctctggcatgatgacctcctagagcccaccaccaagcccagcatcactggcaagttcaag
ctgctagagcctcccatgctgggccacgacctgagactggccctgtgcttggccaacctc
acctcccgggtccagcaggtgagggtcaacctgagcggtgccaccatcctctacacccgc
aagccggtggcagagatcctgcatgaatcccacgccgtgaggctgggacgacaagaagag
aagagaatcccaattacaatatcttactctaagtataaagaagacctgacagaggacaag
aagatcctgttggctgccatgtgcctcgtcaccaaaggagagaagcttctggtggagaag
gacattactctagaggacttcatcaccatcaaggttctgggcccagccatggtgggagtg
gcagttacggtggaagtgacagtagtcaaccccctcttagaaagagtgaaggactgtgcg
ctgatggtggagggcagcggctttctccaggaacagctcagcatcgacgtgcccaccctg
gagcctcaggagagggcctcagtccagtttgacatcaccccctccaagagtggcccaagg
cagttgcaggtggaccttgtaagccctcactttccggacatcaagggttttgtgatcatc
catgtggccactgccaagtga

DBGET integrated database retrieval system