KEGG   Macaca fascicularis (crab-eating macaque): 102134161Help
Entry
102134161         CDS       T02918                                 

Gene name
ART4
Definition
ADP-ribosyltransferase 4 (Dombrock blood group)
Orthology
K06717  
ADP-ribosyltransferase 4 [EC:2.4.2.31]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Brite
Enzymes [BR:mcf01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     102134161 (ART4)
Cellular antigens [BR:mcf04090]
 Proteins
  102134161 (ART4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
11
AA seq 330 aa AA seqDB search
MKMQGQRRSTCDTSKWGPLMNRCKKILLPTTAAPTVIRIWLLGGLLPFLLLLSGLQRPTN
GSEVAMKIDFDFAPGSFDDQYQGCSKEVMEKLTQGDYFTKDIEAQKNYFGMWQKAHLTWL
NQGKVLPQNMTTTHAVAILFYTLNSNVRSNFTRAVAYVARAPQQYERSFQFKYLHYYLTT
AVQLLRKDSVMKNGTPLCYEVHYRTKDVHFSAYTGATIRFGQFLSTSLLKEEAQEFGNQT
LFTIFTCLGAPVQYFSLKKEVLIPPYELFKVINMSSHPRGNWLQLRSTGNLSTYNCQLLK
ASSKKCIPDPIAIASLSFLASVIIFSKSRV
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgcaagggcaaaggagaagcacttgtgatacaagcaaatggggtccattgatg
aacagatgcaagaagattcttctcccaactactgcagctcctacagtgataagaatctgg
ctccttggaggcctgctgccattcctgctgctcctctctggcctgcagagacccacaaac
ggttctgaggttgcgatgaaaatcgactttgacttcgcaccaggttcctttgatgatcag
taccaaggctgtagcaaagaggttatggagaaactaactcaaggggattatttcacaaaa
gacatagaagcccagaagaattactttgggatgtggcaaaaagctcacttaacctggctt
aaccaaggaaaagttctaccccagaacatgactaccacgcatgctgtggctattttgttt
tatacattgaacagcaatgttcgttctaactttactagagccgtggcctatgttgccagg
gctccacagcagtatgaacgttcattccaattcaaatatttacactactacctcaccaca
gcagtccagctgctgaggaaagacagcgtcatgaagaatggcactcctctgtgctatgag
gtgcattataggacgaaggatgtccacttcagcgcctacacaggtgccaccattcgattt
ggccaattcctctccacatccctcctaaaagaagaggcacaggagtttgggaaccagaca
ctatttaccatattcacatgcctgggtgcacctgtacaatacttctccctcaagaaggaa
gtcttgatccctccctatgagttgttcaaagttataaatatgagctcccacccaagagga
aactggttgcagttgaggtcaactgggaacctgagcacgtacaactgtcagctgctaaaa
gcttccagcaagaaatgcatccctgatcctatagctattgcatctctctcctttttggcc
agtgtcatcatcttttccaaaagccgagtataa

DBGET integrated database retrieval system