KEGG   Macaca fascicularis (crab-eating macaque): 102134559Help
Entry
102134559         CDS       T02918                                 

Gene name
GLS2
Definition
glutaminase 2 (liver, mitochondrial)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Glutamatergic synapse
GABAergic synapse
Proximal tubule bicarbonate reclamation
MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mcf00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    102134559 (GLS2)
   00330 Arginine and proline metabolism
    102134559 (GLS2)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    102134559 (GLS2)
 Organismal Systems
  Excretory system
   04964 Proximal tubule bicarbonate reclamation
    102134559 (GLS2)
  Nervous system
   04724 Glutamatergic synapse
    102134559 (GLS2)
   04727 GABAergic synapse
    102134559 (GLS2)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    102134559 (GLS2)
Enzymes [BR:mcf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     102134559 (GLS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
11
AA seq 602 aa AA seqDB search
MRSMKALQKSLSRASSHCRRGDWGHLSRSPLLGEGIRHHLSEAAAQGRETPHSRQPQHQD
HDSSESGMLSRLGDLLFYTIAEGQEQIPIHKFTTALKATGLQTSDPRLQDCMSEMHRVVQ
ESSSGGLLDRDLFRKCVSSNIVLLTQAFRKKFVIPDFEEFTGHVDRIFEDAKELTGGKVA
AYIPQLAKSNPDLWGVSLCTVDGQRHSVGHTKIPFCLQSCVKPLTYAISISTLGTDYVHK
FVGKEPSGLRYNKLSLNEEGIPHNPMVNAGAIVVSSLIKMDCNKAEKFDFVLQYLNKMAG
NEYMGFSNATFQSEKETGDRNYAIGYYLKEKKCFPKGVDMMAALDLYFQLCSVEVTCESG
SVMAATLANGGICPITGESVLSAEAVRNTLSLMHSCGMYDFSGQFAFHVGLPAKSAVSGA
ILLVVPNVMGMMCLSPPLDKLGNSYRGTSFCQKLVSLFNFHNYDNLRHCARKLDPRREGG
EVRNKTVVNLLFAAYSGDVSALRRFALSAMDMEQKDYDSRTALHVAAAEGHIEVVKFLIE
ACKVNPFAKDRWGNIPLDDAVQFNHLEVVKLLQDYQDSYTLSDTQAEAAAEALSKENLES
MV
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgcgctccatgaaggctctgcagaagtcgctgagccgggccagcagtcactgccggcgg
ggagactggggtcacctgagccggagccccctccttggcgagggcatccggcaccacctc
agtgaggccgcggcgcagggcagagagacaccacacagccgccagccgcagcaccaggat
catgattcatcagaaagtggcatgctgtcccgcctgggtgatttgctcttctacactatt
gctgaaggacaggaacaaatccctatccacaagttcaccactgcactaaaggccactgga
ctgcagacatcagatcctcggctccaagactgcatgagcgagatgcaccgtgtggtccaa
gagtccagtagtggtggcctcttggaccgagatctcttccgaaagtgtgtgagcagcaac
attgtgctcctgacccaggcattccgaaagaagtttgtcattcctgattttgaggagttc
acgggccatgtggatcgcatctttgaggatgccaaagagctcactggaggcaaagtggca
gcctacatccctcagctggccaagtcaaacccagacctgtggggtgtctccctgtgcact
gtggatggtcagcggcactctgtgggccacacaaagatccccttctgcctgcagtcctgt
gtgaagcccctcacctatgccatctccataagcaccctaggcactgactacgtgcacaag
tttgtgggcaaagagcctagtggcctgcgctacaacaagctctccctcaatgaggaagga
atcccccataaccccatggtcaatgctggtgccattgttgtcagctccctgatcaagatg
gactgtaacaaagcagagaagtttgattttgtgttgcagtatctcaacaaaatggctggg
aatgaatacatgggtttcagcaatgccacattccagtcggagaaggaaacaggggatcgg
aattatgccattggctattatctcaaggaaaagaagtgctttcctaagggggtggacatg
atggctgcccttgatctctacttccagctgtgctctgtggaggtcacttgtgaatcaggc
agtgtcatggcagccaccctcgccaatggtgggatctgccccatcacaggcgagagtgtg
ctgagtgctgaagcagtgcgcaacaccctcagcctcatgcattcctgcggcatgtatgac
ttctctggccagtttgccttccacgtgggcctgccagccaagtcagctgtatcaggagcc
atcctcctggtggtacccaatgtcatgggaatgatgtgcctgtcacccccactggacaag
ctggggaacagctatagggggaccagcttctgccagaagttggtgtctctcttcaatttc
cacaactatgacaacctgaggcactgtgctcggaagttagacccacggcgtgaaggggga
gaagttcggaacaagactgtggtcaacctgttatttgcggcctacagtggtgatgtctca
gctcttcgaaggtttgccttgtcggccatggatatggaacagaaagactatgactcgcgc
acagctctgcatgttgctgcagctgaaggacacatcgaagttgttaaattcctgatcgag
gcttgcaaagtgaatccttttgccaaggacagatggggcaacattcccctggatgatgct
gtgcagttcaaccatctggaggtggtcaaactgcttcaagattaccaggattcctacaca
ctctctgacactcaggctgaggcagcagctgaggccctgtctaaagagaacttagaaagc
atggtatga

  All links  
No link information was found.   
DBGET integrated database retrieval system