KEGG   Macaca fascicularis (crab-eating macaque): 102135068Help
Entry
102135068         CDS       T02918                                 

Gene name
ART3
Definition
ADP-ribosyltransferase 3
Orthology
K00775  
NAD(P)-arginine ADP-ribosyltransferase [EC:2.4.2.31]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Brite
Enzymes [BR:mcf01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     102135068 (ART3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 338 aa AA seqDB search
MADNAFDDEYLKCTDRMEIKYVPQLLKEEKASHQQLDTVWENAKAKWAARKTQIFLPVNF
KDNHGIALMAYISEAQEQTPFYHLFSEAVKMAGQSREDYIYGFQFKAFHFYLTRALQLLR
RPCEANSKNVVYRTSQGTSFTFGGLNQARFGHFTLAYSVKPQAADDQLTVLSIYTCLGVD
IEKFLDKESERITLIPLNEVFQVLQEGAGNNLILQSTNKTCSHYECAFLGGLKTENCVEN
LEYFQPVYVYNPGEKTQKLEDHGEKNQKLEDRGVKILEPTEIPEDKSQGNINNPTPGPVP
VPGPKSHPSASLGKMLLPEFGMVIILISVSAINLFVAL
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atggcagataatgcatttgatgatgaatacctgaaatgtactgacaggatggaaattaaa
tacgttccccaactgctaaaggaggaaaaagcaagccaccagcaattagatactgtgtgg
gaaaatgcaaaagccaaatgggcagcccgaaagactcaaatctttctccctgtgaatttt
aaggataaccatggaatagctctgatggcatatatttccgaagctcaagagcaaactccc
ttttaccatctgttcagtgaagctgtgaagatggctgggcaatctcgagaagattatatc
tatggcttccagttcaaagctttccacttttacctgacaagagccctgcagttgctgaga
agaccttgtgaggccaattccaaaaatgtggtatatagaacaagccagggcacttcattt
acatttggagggctaaaccaagccaggtttggccattttaccttggcatattcagtcaaa
cctcaggctgctgatgaccagctcactgttttatccatctacacatgccttggagttgac
attgaaaaatttcttgataaagaaagtgaaagaattactttaatacctctgaatgaggtt
tttcaagtgttgcaggaaggggctggcaataaccttatccttcaaagcacaaacaagacc
tgcagccattatgagtgtgcatttctaggtggactaaaaactgaaaactgtgttgagaac
ctagaatattttcaacccgtctatgtctacaaccctggtgagaaaacccagaagcttgaa
gaccacggtgagaaaaaccagaagcttgaagaccgtggtgtgaaaatccttgaacccacc
gaaataccagaagataaaagtcaaggaaatatcaacaatcctactccaggtccagttcct
gttccaggtcccaaaagccatccttctgcatccttgggcaaaatgctgcttccagagttt
gggatggtcatcattttaatcagtgtttctgctataaatctctttgttgctctgtag

DBGET integrated database retrieval system