KEGG   Macaca fascicularis (crab-eating macaque): 102137839Help
Entry
102137839         CDS       T02918                                 

Gene name
C1GALT1
Definition
(RefSeq) core 1 synthase, glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1
  KO
K00731  
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
Mucin type O-glycan biosynthesis
Metabolic pathways
Module
O-glycan biosynthesis, mucin type core
Brite
KEGG Orthology (KO) [BR:mcf00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    102137839 (C1GALT1)
Enzymes [BR:mcf01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.122  glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase
     102137839 (C1GALT1)
Glycosyltransferases [BR:mcf01003]
 Glycan extension
  Type 3 chain
   102137839 (C1GALT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
3
AA seq 371 aa AA seqDB search
MSEIHFREMASKSWLNFLTFLCGSAIGFLLCSQLFSILLGEQGDIQPNVLHNDPHARHSD
DNGQNHLEGEMNFNADSSQHKDENTDIAENLYQKVKILCWVMTGPQNLEKKAKHVKATWA
QRCNKVLFMSSEENKDFPAVGLKTKEGRDQLYWKTIKAFQYVHEHYLEDADWFLKADDDT
YVILDNLRWLLSKYDPEEPIYFGRRFKPYVKQGYMSGGAGYVLSKEALKRFVDAFKTDKC
THSSSIEDLALGRCMEIINVEAGDSRDTTGKETFHPFVPEHHLIKGYLPRTFWYWNYNYY
PPVEGPGCCSDLAVSFHYVDSTTMYELEYLVYHLRPYGYLYRYQPTLPEDILKEISQANK
KEDTKVKLGNP
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaaatacactttcgggaaatggcctctaaatcctggctgaattttttaaccttc
ctctgtggatcagcaataggatttcttttatgttcccagctatttagtattttgttggga
gaacagggtgacatccagcctaatgttcttcataatgatcctcatgcgaggcattcagat
gataatggacagaatcatctagaaggagaaatgaacttcaatgcagattctagccaacat
aaagatgagaacacagacatcgctgaaaacctctatcagaaagttaaaattctttgctgg
gttatgaccggccctcaaaacctagagaaaaaggccaaacatgtcaaagctacatgggcc
cagcgttgtaacaaagtgttgtttatgagttcagaagaaaataaagacttccctgctgtg
ggattgaaaaccaaagaaggcagagatcaactatactggaaaacaattaaagcttttcag
tatgttcatgaacattatttagaagatgctgattggtttttgaaagcagatgatgacaca
tatgtcatactagacaatttgaggtggcttctttcgaaatacgaccctgaagaacccatt
tactttgggagaagatttaagccctatgtaaaacagggctacatgagtggaggagcagga
tatgtactaagcaaagaagccttgaaaagatttgttgatgcatttaaaacagacaagtgt
acacatagttcctccattgaagacttagcactggggagatgcatggaaattataaatgta
gaagcaggagattccagagataccactggaaaagaaacttttcatccctttgtgccagaa
caccatttaattaaaggttatctacctagaaccttttggtactggaattacaactattat
cctcctgtagagggtcctggttgctgttctgatcttgcagtttcttttcattatgttgat
tctacaactatgtatgagttagaatacctcgtttatcatcttcgtccatatggttattta
tacagatatcaacctaccttacctgaagatatactaaaggaaattagtcaagcaaacaaa
aaggaagatacaaaagtgaagttaggaaacccttga

DBGET integrated database retrieval system