KEGG   Macaca fascicularis (crab-eating macaque): 102139527Help
Entry
102139527         CDS       T02918                                 

Gene name
DBH
Definition
dopamine beta-hydroxylase (dopamine beta-monooxygenase)
Orthology
K00503  
dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
Tyrosine metabolism
Metabolic pathways
Module
Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:mcf00350]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
15
AA seq 620 aa AA seqDB search
MQAPSRWCRWASLPCPSMREAAFMYSTAVAVFLVILVAALQGSAPPESPFLYRIPLDPEE
SLELSWNVSYPQEAIFFQLLVKQLKAGVLFGMSDRGELENADLVVLWTDGDTAYFADAWS
DQKGQIHLDPQQDYQLLQVERTPEGLALLFKRPFGTCDPKDYLIEDGTVHLVYGILEEPF
RSLEAINSSGLRTGLQRVQLLKPNITFPATPSDTYTMDIHAPDIQIPNQVTTYWCYIHEL
PEGFPRHHIVKYEPIVTKGNEALVHHMEIFQCAPEMDNVPHFNGPCDSKMKPDRLNYCRH
VLAAWALGAKAFYYPEEAGIAFGGPGSSRYVRLEVHYHNPLVIEGRRDSSGIRLYYTDKL
RRFNAGIMELGLVYTPVMAIPPRETAFVLTGYCTDKCTQLALPPSGIHIFASQLHTHLTG
RKVVTVLARDGREWEIVNQDNHYSPHFQEIRMLKKMVSVHRGDVLITSCTYNTEDRELAT
VGGFGILEEMCVNYVHYYPQTQLELCKSAVNAGFLQKYFHLINRFNNEEVCTCPQASVSQ
QFASVPWNSFNREVLKALYAFAPISMHCNKSSAVRFPGEWNLQPLPKVISTLEEPTPQCP
TSQGRSPAGPTIISIGGGKG
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcccccagtcggtggtgtcgctgggccagtctaccctgccccagcatgcgggag
gcggccttcatgtacagcacagcagtggccgtcttcctggtcatcctggtggctgcactg
cagggctcggctccccctgagagccccttcctctaccgcatccccctggaccccgaggag
tccctggagctctcatggaatgtcagctacccccaggaggccatcttcttccagctcctg
gtgaagcagctcaaggctggagtcctgtttgggatgtccgaccgtggcgagcttgagaac
gcagacctcgtggtgctctggaccgatggggacactgcttattttgcggacgcctggagt
gaccagaaggggcagatccacctggatccccagcaggactaccagctgctgcaggtggag
aggacgccagaaggcctggccctgcttttcaagaggccctttggcacctgcgaccccaag
gattacctcatcgaggacggcacagtccacttggtctacgggatcctggaggagccattc
cggtcactggaggccatcaacagctcaggcctgcggacggggctacagagggtgcagctc
ctgaagcccaatatcaccttcccggccacgccctcagacacgtacaccatggatatccac
gctcccgatatccagatccccaaccaggtgaccacgtactggtgctacatccacgagctt
cccgagggcttccctcggcaccacattgtcaagtacgagcccatcgtcaccaagggcaac
gaggccctcgtgcaccacatggaaatcttccagtgcgcccccgagatggacaacgttccc
catttcaacgggccctgtgactccaagatgaaacctgaccgcctcaactactgccgccac
gtgctggctgcctgggccctgggtgccaaggcattttactacccggaggaagccggcatt
gccttcgggggccctgggtcctccagatacgtccgcctggaagttcactaccacaacccg
ctggtgatagaaggacggcgcgactcctcaggcatccgcttgtactacacagacaagctg
cggcgcttcaatgcggggatcatggagctgggactggtgtacacgccagtgatggctatt
ccgccgcgggagactgccttcgtcctcactggctactgcacagacaagtgtacccagttg
gcactgcctccctccgggatccacatcttcgcctctcagctccacacacacctgactggg
agaaaggtggtcacggtgctggcccgggacggccgggagtgggagatcgtgaatcaggac
aatcactacagccctcacttccaggagatccgcatgttgaagaagatggtgtcggtccat
cggggagatgtgctcatcacgtcctgcacgtacaacacggaagaccgggagctggccaca
gtgggcggctttgggatcctggaggagatgtgtgtcaactatgtgcactactacccccag
acgcagctggagctctgcaagagtgctgtgaacgccggcttcctgcagaagtacttccac
ctcatcaacaggttcaacaatgaggaggtctgcacctgccctcaggcatccgtgtctcag
cagttcgcctctgttccctggaactccttcaaccgcgaagtactgaaggccctgtacgcc
ttcgcgcccatctccatgcactgcaacaagtcctcagctgtccgcttcccgggtgaatgg
aacctgcagcccctgcccaaggtcatctccacgctggaagaacccaccccacagtgcccc
accagccagggccgaagccctgccggccccaccattatcagcattggtgggggcaaaggc
tga

DBGET integrated database retrieval system