KEGG   Macaca fascicularis (crab-eating macaque): 102139792Help
Entry
102139792         CDS       T02918                                 

Gene name
ART5
Definition
ADP-ribosyltransferase 5
Orthology
K00775  
NAD(P)-arginine ADP-ribosyltransferase [EC:2.4.2.31]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Brite
Enzymes [BR:mcf01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     102139792 (ART5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
14
AA seq 450 aa AA seqDB search
MGRGPREGREWALLRCWSTWPKVWAKCKLCNSECSRGDLLAGGTSAGPPGLVVWGPGADR
VRDRLRERPSLTSSFPLTAKEGPAERPRSPGEGELPLSPCPAAAAPGPACGAGKGVSGYQ
RGGSSYPREPCFQPDSGDSAAPARALGATSCSRPPQPSGMALASLMMALGCLGLHTWQAQ
AVPILPLGLAPDTFDDAYVGCAEEMEEKAAPLLKAEMAHHALLRESWEAAQEAWEDRHRG
LTLPPGFKAQNGIAIMVYTNSSNTLYWKLNQAVRTGGGSRELYMRHFPFKALHFYLIRAL
QLLRGGGGCSTGPGEVVFRGVGSLRFEPKRLGDSVRLGQFASSSLDKAVACRFGNATLFS
LMTCFGAPIQAFSVFPKEREVLIPPHEVFLVTRFSQDGAQSLVTLWSYNQTCSHFNCAYL
GGEKRRGCVSAPGALGTGDLHMKKRRLQQP
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atggggagagggcccagagaagggagggagtgggcgctgctcagatgctggagcacgtgg
cccaaggtgtgggccaaatgcaaactctgcaattcagagtgctccaggggcgaccttttg
gctggcgggacctccgcggggccccctggcctggtcgtctgggggccaggggccgaccgg
gtcagggaccgcctgagggagagaccaagtctcacaagttccttccccctcacagccaaa
gagggtcccgcagaaagaccccgcagtcctggagaaggggagttgcccctcagcccctgc
cccgccgcggccgctcccggccccgcgtgcggcgctgggaaaggggtgtcgggttaccag
cgcgggggctctagttaccctcgggaaccttgctttcagccggactccggggacagcgca
gcgcccgcccgagccctcggcgctacctcctgctcgcggcctccgcaaccttcagggatg
gcactggcgtcactgatgatggccctcggctgccttggcctccacacctggcaggcccag
gctgttcccatcctgcccctgggactggctccagacacctttgacgatgcctatgtgggt
tgtgcagaggagatggaggagaaggcagcccccctgctaaaggcggaaatggcccaccat
gccctgcttcgggaatcctgggaggcagcccaggaggcctgggaggacaggcatcgaggg
ctcaccttaccccctggcttcaaagcccagaatggaatagccattatggtctacaccaac
tcatctaacaccttgtactggaagttgaatcaggccgtgcggacaggcggaggctcccgg
gagctctacatgaggcactttcccttcaaggccctgcatttctacctgatccgggccctg
cagctgcttcgaggcggtgggggctgcagcacagggcctggggaggtggtgttccgaggt
gtgggcagccttcgctttgaacccaaaaggctgggggactctgtccgcttaggccagttt
gcctccagctccctggataaggcagtggcctgcagatttggtaatgccaccctcttttct
ctaatgacttgctttggggcccctatccaggccttctctgtctttcccaaggagcgcgag
gtgctgattcccccccatgaagtcttcttggtcaccagattctctcaggatggagcccag
agcctggtgactctctggagctataatcagacctgcagccactttaactgcgcctatctg
ggtggggagaagaggcggggctgtgtgtctgcaccaggagccctgggaacgggtgacctt
catatgaagaagaggcgcctccaacagccttga

DBGET integrated database retrieval system