KEGG   Macaca fascicularis (crab-eating macaque): 102139968Help
Entry
102139968         CDS       T02918                                 

Gene name
PCSK2
Definition
(RefSeq) proprotein convertase subtilisin/kexin type 2
  KO
K01360  proprotein convertase subtilisin/kexin type 2 [EC:3.4.21.94]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Brite
Enzymes [BR:mcf01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.94  proprotein convertase 2
     102139968 (PCSK2)
Peptidases [BR:mcf01002]
 Serine Peptidases
  Family S8: subtilisin family
   102139968 (PCSK2)
Chaperones and folding catalysts [BR:mcf03110]
 Intramolecular chaperones
  Subtilisin family
   102139968 (PCSK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S8 P_proprotein S8_pro-domain Peptidase_S8_N
Motif
Other DBs
NCBI-GeneID: 102139968
NCBI-ProteinID: XP_005568356
UniProt: G7PH08
Position
10
AA seq 638 aa AA seqDB search
MKGGCVSQWKAAAGFLFCVMVFASAERPVFTNHFLVELHKGGEDEARQVAAEHGFGVRKL
PFAEGLYHFYHNGLAKAKRRRSLHHKQQLERDPRVKMALQQEGFDRKKRGYRDINEIDIN
MNDPLFTKQWYLINTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLASN
YNAEASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAANNNICGVGVAYNSKVAGIRM
LDQPFMTDIIEASSISHMPQLIDIYSASWGPTDNGKTVDGPRELTLQAMADGVNKGRGGK
GSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRK
RNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANLGLTWRDMQHLTVLTSKRN
QLHDEVHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSVQDPEKIP
STGKLVLTLTTDACEGKENFVRYLEHVQAVITVNATRRGDLNINMTSPMGTKSILLSRRP
RDDDSKVGFDKWPFMTTHTWGEDARGTWTLELGFVGSAPQKGVLKEWTLMLHGTQSAPYI
DQVVRDYQSKLAMSKKEELEEELDEAVERSLKSILSKN
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgaagggtggttgtgtctcccagtggaaggcggccgccgggttcctcttctgtgtcatg
gtttttgcatctgctgagcgaccggtcttcacgaatcattttcttgtggagttgcataaa
gggggagaggacgaagctcgccaagttgcagcagaacacggctttggagtccgaaagctt
ccctttgctgaaggtctgtaccacttttatcacaatggccttgcaaaggccaagagaaga
cgcagcctacaccacaagcagcagctggagagagaccctagggtaaagatggctttacag
caggaaggatttgaccgaaaaaagcgaggttacagagacatcaatgagatcgacatcaac
atgaacgatcctctttttacaaagcaatggtatctgatcaatactggccaagctgatggc
actcctggccttgatttgaatgtggctgaagcctgggagctgggatacacagggaagggt
gttaccattggaattatggatgatgggattgactatctccacccggacctggcctccaac
tataatgccgaagcaagttacgacttcagtagcaacgacccctatccttaccctcggtac
acagacgactggtttaacagccatgggacccgatgtgcaggagaagtttctgctgccgcc
aacaacaatatctgtggggtcggagtagcatacaactccaaggttgcaggcatccggatg
ctggaccagccgttcatgacagacatcatcgaggcctcctccatcagccacatgccgcag
ctgatcgacatctacagcgccagctggggccccacagacaacggcaagacagtggatggg
ccccgggagctcacgctgcaggccatggccgatggcgtgaacaagggccgcggcggcaag
ggcagcatctatgtgtgggcctccggggacggcggcagctatgatgactgcaactgcgac
ggctacgcctccagcatgtggaccatctccatcaactcagccatcaacgacggcaggacc
gccctgtacgacgagagctgctcttccaccctggcttccaccttcagcaacgggaggaaa
aggaaccctgaggccggtgtggcaaccacagatttgtacggcaactgcactctgaggcat
tctgggacatctgcagctgcccctgaggcagctggcgtgtttgcactggctctggaggct
aacctgggtctgacctggcgggacatgcagcatctgactgtgctcacctccaaacggaac
cagcttcacgacgaagttcatcagtggcggcgcaacggggtcggcctggaatttaatcac
ctctttggctacggggtccttgatgcaggcgccatggtgaaaatggctaaagactggaaa
accgtgcccgagagattccactgtgtgggaggctccgtgcaggaccctgagaaaatacca
tccactggcaagttggtgctgacactcacaaccgatgcctgtgaggggaaggaaaatttt
gtccgctatctggagcatgtccaggctgtcatcacggtcaacgcgaccaggagaggagac
ctgaacatcaacatgacttcccctatgggcaccaagtccattttgctgagccggcgtccg
agggatgacgactccaaggtgggctttgacaagtggcctttcatgaccacccacacgtgg
ggggaagacgcccgaggcacctggaccctggagctggggtttgtcggcagtgccccgcag
aagggggtgctgaaggagtggaccctgatgctgcatggcactcagagcgccccgtacatc
gaccaggtggtgcgggattaccagtccaagctggccatgtccaagaaagaggagctggag
gaagagctggacgaagccgtggagagaagcctgaaaagcatccttagcaagaactag

DBGET integrated database retrieval system