KEGG   Macaca fascicularis (crab-eating macaque): 102140167Help
Entry
102140167         CDS       T02918                                 

Gene name
POMT1
Definition
protein-O-mannosyltransferase 1
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:mcf00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    102140167 (POMT1)
Enzymes [BR:mcf01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose---protein mannosyltransferase
     102140167 (POMT1)
Glycosyltransferases [BR:mcf01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   102140167 (POMT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
15
AA seq 747 aa AA seqDB search
MWGFLKRPIVVTADINLSLVALTGMGLLSRLWRLTYPPAVVFDEVYYGQYISFYMKRIFF
LDDSGPPFGHMVLALGGYLGGFDGHFLWNRIGAEYSSNVPVWSLRLLPALAGALSVPMAY
QIVLELHFSHCAAMGAALLMLIENALITQSRLMLLESVLIFFNLLAVLSYLKFFNCQKHS
PFSLSWWFWLTLTGVACSCAVGIKYMGMFTYVLMLAVAAVHAWHLIGDQTLSNVGADVQC
CMRQACVGQMGMSQGVCVFCHLLARAVALLVIPVVLYLLFFYVHLILLFRSGPHDQIMSS
AFQASLEGGLARITQGQPLEVAFGSQVTLRNVFGKPVPCWLHSHQDTYPMIYENGRGSSH
QQQVTCYPFKDVNNWWIVKDPGRHQLVVSSPPRPVRHGDMVQLVHGMTTRSLNTHDVAAP
LSPHSQEVSCYIDYNISMPAQNLWRLEIVNRGSDTDVWKTILSEVRFVHVNTSAVLKLSG
AHLPDWGYRQLEIVGEKLSRGYHESMVWNVEEHRYGASQEQRERERELHSPAQVDVSRNL
SFMARFLELQWKMLVLRSDDSEHKYSSSPLEWVTLDTNIAYWLHPRTSAQIHLLGNIVIW
ISGSLALAIYALLSLWYLLRRRRNVHDLPQDAWLRWVLAGALCAGGWAVNYLPFFLMEKT
LFLYHYLPALTFQILLLPVVLQHISDHLCRSQLQRSVFSALVVAWYSSACHVSHTLRPLT
YGDKSLSPHELKALRWKDSWDILIRKH
NT seq 2244 nt NT seq  +upstreamnt  +downstreamnt
atgtggggatttttgaagcgccctatagtggtgacggctgacatcaacttgagcctcgtg
gccctgactgggatggggttactgagccggctgtggcgactcacgtacccgccggctgtg
gtttttgacgaagtgtattatgggcagtacatctctttttacatgaaacgaatcttcttc
ttggatgacagtgggccgccatttggccacatggtgctggccttgggaggttatttagga
ggattcgatggccattttttgtggaacagaattggagcagaatacagtagcaacgtgccc
gtgtggtccctgcgcctgctgccagcgctcgcgggggccttgtccgtccccatggcctac
cagatagtgctggagctccacttttctcattgtgccgccatgggagctgctctgttgatg
cttatcgagaatgctctcatcactcagtcaaggctaatgcttttggaatcagtgttaata
ttttttaatctattggccgtgttgtcctacctgaagttcttcaattgccaaaagcacagc
cctttttctctgagctggtggttctggctaacactgacaggggttgcttgttcctgcgca
gtgggcatcaagtacatgggtatgttcacatacgtgctcatgctggcggttgcagctgtc
catgcctggcacctaattggagaccagactttgtccaacgtaggtgctgacgtccagtgc
tgcatgaggcaggcctgtgtggggcagatggggatgtcacagggggtctgtgtgttctgt
cacttgcttgcccgagcagtggctttgctggtcatcccggtcgtcctgtacttactgttc
ttctacgtccatttgattctgctcttccgctctgggccccacgaccaaatcatgtccagt
gccttccaggccagcttagagggaggactagctcggatcacccagggtcagccgctggag
gtggcctttgggtcccaggtcactctgaggaacgtctttgggaaacctgtgccctgctgg
ctgcattcccaccaggacacctaccccatgatatatgagaacggccgaggcagctcccac
cagcagcaggtgacctgttaccccttcaaagacgtcaataactggtggattgtaaaggat
cccgggaggcaccagctggtggtgagcagccctccgagacccgtgcggcacggggacatg
gtgcagctggtccacggcatgaccacccgctccctgaacacgcatgatgttgcagcccct
ctgagtccccattcacaggaggtctcctgctacattgactataatatctccatgcccgcc
cagaacctctggagactggaaattgtgaacagaggatccgacacagacgtctggaagacc
atcctctcagaggtccgctttgtgcacgtgaacacttctgcggtcttaaagctgagcggg
gctcacctccctgactgggggtatcggcagctggagatcgtcggggagaagctgtcccgg
ggctaccacgagagcatggtgtggaacgtggaggagcaccgatacggcgcgagccaggag
cagagggagcgggaacgggagctgcactcacctgcgcaggtggacgtcagcaggaacctc
agcttcatggcgagattcttggagctgcagtggaagatgctggtgctgagaagcgatgac
tcggaacacaagtatagctccagcccgctggagtgggtcaccctggacaccaatatcgcc
tactggctgcaccccaggaccagcgctcagatccacctacttggaaacatagtgatctgg
atttcaggcagcctcgccctggccatctacgccctgctgtccttgtggtacctgctccga
cggcgaagaaacgtccatgacctccctcaggatgcctggctgcgctgggtgttggctggg
gcgctgtgtgctggtggctgggcagtgaactacctcccgttcttcctgatggagaagaca
ctcttcctctaccactacctgcccgcactcaccttccagatccttctgctccctgtcgtc
ctgcagcacatcagcgaccacctgtgcaggtcccagctccagaggagcgtcttcagcgcc
ctggtggtggcctggtactcctccgcatgccatgtgtcccacacgctgcgcccactcacc
tacggggacaagtcactctcgccacatgaactcaaggcccttcgctggaaagacagctgg
gacatcttgatccgaaaacactag

DBGET integrated database retrieval system