KEGG   Macaca fascicularis (crab-eating macaque): 102140167Help
Entry
102140167         CDS       T02918                                 

Gene name
POMT1
Definition
(RefSeq) protein O-mannosyltransferase 1
  KO
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
Other types of O-glycan biosynthesis
Mannose type O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:mcf00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00515 Mannose type O-glycan biosyntheis
    102140167 (POMT1)
   00514 Other types of O-glycan biosynthesis
    102140167 (POMT1)
Enzymes [BR:mcf01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose---protein mannosyltransferase
     102140167 (POMT1)
Glycosyltransferases [BR:mcf01003]
 O-Glycan biosynthesis
  O-linked Man type
   102140167 (POMT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
15
AA seq 725 aa AA seqDB search
MWGFLKRPIVVTADINLSLVALTGMGLLSRLWRLTYPPAVVFDEVYYGQYISFYMKRIFF
LDDSGPPFGHMVLALGGYLGGFDGHFLWNRIGAEYSSNVPVWSLRLLPALAGALSVPMAY
QIVLELHFSHCAAMGAALLMLIENALITQSRLMLLESVLIFFNLLAVLSYLKFFNCQKHS
PFSLSWWFWLTLTGVACSCAVGIKYMGMFTYVLMLAVAAVHAWHLIGDQTLSNVCVFCHL
LARAVALLVIPVVLYLLFFYVHLILLFRSGPHDQIMSSAFQASLEGGLARITQGQPLEVA
FGSQVTLRNVFGKPVPCWLHSHQDTYPMIYENGRGSSHQQQVTCYPFKDVNNWWIVKDPG
RHQLVVSSPPRPVRHGDMVQLVHGMTTRSLNTHDVAAPLSPHSQEVSCYIDYNISMPAQN
LWRLEIVNRGSDTDVWKTILSEVRFVHVNTSAVLKLSGAHLPDWGYRQLEIVGEKLSRGY
HESMVWNVEEHRYGASQEQRERERELHSPAQVDVSRNLSFMARFLELQWKMLVLRSDDSE
HKYSSSPLEWVTLDTNIAYWLHPRTSAQIHLLGNIVIWISGSLALAIYALLSLWYLLRRR
RNVHDLPQDAWLRWVLAGALCAGGWAVNYLPFFLMEKTLFLYHYLPALTFQILLLPVVLQ
HISDHLCRSQLQRSVFSALVVAWYSSACHVSHTLRPLTYGDKSLSPHELKALRWKDSWDI
LIRKH
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgtggggatttttgaagcgccctatagtggtgacggctgacatcaacttgagcctcgtg
gccctgactgggatggggttactgagccggctgtggcgactcacgtacccgccggctgtg
gtttttgacgaagtgtattatgggcagtacatctctttttacatgaaacgaatcttcttc
ttggatgacagtgggccgccatttggccacatggtgctggccttgggaggttatttagga
ggattcgatggccattttttgtggaacagaattggagcagaatacagtagcaacgtgccc
gtgtggtccctgcgcctgctgccagcgctcgcgggggccttgtccgtccccatggcctac
cagatagtgctggagctccacttttctcattgtgccgccatgggagctgctctgttgatg
cttatcgagaatgctctcatcactcagtcaaggctaatgcttttggaatcagtgttaata
ttttttaatctattggccgtgttgtcctacctgaagttcttcaattgccaaaagcacagc
cctttttctctgagctggtggttctggctaacactgacaggggttgcttgttcctgcgca
gtgggcatcaagtacatgggtatgttcacatacgtgctcatgctggcggttgcagctgtc
catgcctggcacctaattggagaccagactttgtccaacgtctgtgtgttctgtcacttg
cttgcccgagcagtggctttgctggtcatcccggtcgtcctgtacttactgttcttctac
gtccatttgattctgctcttccgctctgggccccacgaccaaatcatgtccagtgccttc
caggccagcttagagggaggactagctcggatcacccagggtcagccgctggaggtggcc
tttgggtcccaggtcactctgaggaacgtctttgggaaacctgtgccctgctggctgcat
tcccaccaggacacctaccccatgatatatgagaacggccgaggcagctcccaccagcag
caggtgacctgttaccccttcaaagacgtcaataactggtggattgtaaaggatcccggg
aggcaccagctggtggtgagcagccctccgagacccgtgcggcacggggacatggtgcag
ctggtccacggcatgaccacccgctccctgaacacgcatgatgttgcagcccctctgagt
ccccattcacaggaggtctcctgctacattgactataatatctccatgcccgcccagaac
ctctggagactggaaattgtgaacagaggatccgacacagacgtctggaagaccatcctc
tcagaggtccgctttgtgcacgtgaacacttctgcggtcttaaagctgagcggggctcac
ctccctgactgggggtatcggcagctggagatcgtcggggagaagctgtcccggggctac
cacgagagcatggtgtggaacgtggaggagcaccgatacggcgcgagccaggagcagagg
gagcgggaacgggagctgcactcacctgcgcaggtggacgtcagcaggaacctcagcttc
atggcgagattcttggagctgcagtggaagatgctggtgctgagaagcgatgactcggaa
cacaagtatagctccagcccgctggagtgggtcaccctggacaccaatatcgcctactgg
ctgcaccccaggaccagcgctcagatccacctacttggaaacatagtgatctggatttca
ggcagcctcgccctggccatctacgccctgctgtccttgtggtacctgctccgacggcga
agaaacgtccatgacctccctcaggatgcctggctgcgctgggtgttggctggggcgctg
tgtgctggtggctgggcagtgaactacctcccgttcttcctgatggagaagacactcttc
ctctaccactacctgcccgcactcaccttccagatccttctgctccctgtcgtcctgcag
cacatcagcgaccacctgtgcaggtcccagctccagaggagcgtcttcagcgccctggtg
gtggcctggtactcctccgcatgccatgtgtcccacacgctgcgcccactcacctacggg
gacaagtcactctcgccacatgaactcaaggcccttcgctggaaagacagctgggacatc
ttgatccgaaaacactag

DBGET integrated database retrieval system