KEGG   Macaca fascicularis (crab-eating macaque): 102142531Help
Entry
102142531         CDS       T02918                                 

Gene name
ART1
Definition
ADP-ribosyltransferase 1
Orthology
K06716  
ADP-ribosyltransferase 1 [EC:2.4.2.31]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Brite
Enzymes [BR:mcf01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     102142531 (ART1)
Cellular antigens [BR:mcf04090]
 Proteins
  102142531 (ART1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
14
AA seq 383 aa AA seqDB search
MQMPAMMSLLLVSVGLMEALQAQSHPITRRDLFSQEMPLDMALASFDDQYAGCAAAMTAA
LPDLNHTEFQANKVYADGWTLASSQWQERQAWGPEWSLSPTRPPPPPLGFRDEHGVALLA
YTANSPLHKEFNAAVREAGRSRAHYLHHFSFKTLHFLLTEALQLLGRGQRPPRCHQVFRG
VHGLHFRPAGPGATVRLGGFASASLKNVAAQQFGEDTFFGIWTCLGAPIKGYSFFPGEEE
VLIPPFETFQVINASRPAQGPARIYLRALGKRSTYNCEYIKDKKCKSGPCHLDNSDTWCA
KAYPGHHVSRWEWAISREEAAVPPQAFRTPLSFRTLHGSEPPLCSFVSAAAALVPRSEGL
SRQSRPPLMHETRDSLTCCLCPS
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgcagatgcctgctatgatgtctctgcttcttgtgtctgtgggcctcatggaagcactt
caggcccagagccaccccatcacacgacgagacctcttctctcaagagatgccactggac
atggccctggcttcctttgatgaccagtacgctggctgtgctgctgccatgacagctgct
cttccagatctcaaccacacggagttccaggccaacaaggtgtatgcagacggctggaca
ctggcaagcagccaatggcaggagcgccaggcctgggggccagagtggagtctcagccct
acccgtccacccccgccacccctgggcttccgcgatgagcatggggtggccctcctggcc
tacacagccaacagccccctgcacaaggagttcaatgcagccgtacgtgaggcaggtcgc
tcccgggcccactacctccatcacttctccttcaagacactccatttcctgctgaccgag
gccctgcagctcctgggcaggggccagcgtccaccccggtgccaccaggtgttccgaggt
gtgcatggcctgcacttccggccagcagggcccggggccactgtgaggctggggggcttt
gcttccgcctccctgaagaatgttgcggcccagcagtttggtgaggacaccttctttggc
atctggacctgcctcggggcccctatcaagggctactccttcttccctggagaggaagag
gtgctgatcccccccttcgagaccttccaagtgatcaatgccagcagaccggcccagggc
cccgcccgcatctacctccgggctctgggcaagcgcagcacctacaactgcgagtacatc
aaagacaagaagtgcaagtctgggccttgccatctggataattcagacacttggtgtgcc
aaggcctacccaggtcaccatgtctctaggtgggaatgggccatttccagggaagaagca
gcagttcctccccaagcctttagaactcctctgtccttcagaactctccatgggtcagag
ccccctctctgcagtttcgtctctgctgctgctgctctggttcctcgcagtgagggcctt
tccagacagtccaggcctcctttgatgcatgagacacgggacagcctcacctgctgcctc
tgcccatcctga

  All links  
No link information was found.   
DBGET integrated database retrieval system