KEGG   Macaca fascicularis (crab-eating macaque): 102142689Help
Entry
102142689         CDS       T02918                                 

Gene name
KAT2B
Definition
(RefSeq) lysine acetyltransferase 2B
  KO
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
Notch signaling pathway
Thyroid hormone signaling pathway
HTLV-I infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mcf00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    102142689 (KAT2B)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    102142689 (KAT2B)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    102142689 (KAT2B)
  Infectious diseases
   05166 HTLV-I infection
    102142689 (KAT2B)
Enzymes [BR:mcf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102142689 (KAT2B)
Transcription machinery [BR:mcf03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     102142689 (KAT2B)
Chromosome [BR:mcf03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    102142689 (KAT2B)
   HAT complexes
    PCAF complex
     102142689 (KAT2B)
    STAGA complex
     102142689 (KAT2B)
    TFTC complex
     102142689 (KAT2B)
    SAGA complex
     102142689 (KAT2B)
    SLIK complex
     102142689 (KAT2B)
    ADA-HAT complex
     102142689 (KAT2B)
    HAT-A2 complex
     102142689 (KAT2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 675 aa AA seqDB search
MNRLLGIVLDVEYLFTCVHKEEDADTKQVYFYLFKLLRKSILQRGKPVVEGSLEKKPPFE
KPSIEQGVNNFVQYKFSHLPAKERQTIVELAKMFLNRINYWHLEAPSQRRLRSPNDDISG
YKENYTRWLCYCNVPQFCDSLPRYETTQVFGRTLLRSVFTVMRRQLLEQARQEKDKLPLE
KRTLILTHFPKFLSMLEEEVYSQNSPIWDQDFLSASSRTSQLGIQTVISPPPVAGTISYN
STSSSLEQSNAGSSSPACKASSGLEANPGEKRKMTDSHVLEEAKRPRVMGDIPMELINEV
MSTITDPAAMLGPETNFLSAHSARDEAARLEERRGVIEFHVVGNSLNQKPNKKILMWLVG
LQNVFSHQLPRMPKEYITRLVFDPKHKTLALIKDGRVIGGICFRMFPSQGFTEIVFCAVT
SNEQVKGYGTHLMNHLKEYHIKHDILNFLTYADEYAIGYFKKQGFSKEIKIPKTKYVGYI
KDYEGATLMGCELNPRIPYTEFSVIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKDGVRQ
IPIESIPGIRETGWKPSGKEKSKEPRDPDQLYSTLKSILQQVKSHQSAWPFMEPVKRTEA
PGYYEVIRFPMDLKTMSERLKNRYYVSKKLFMADLQRVFTNCKEYNPPESEYYKCANILE
KFFFSKIKEAGLIDK
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atgaacagactcctgggaatagtattggatgtggaatatctctttacctgtgtccacaag
gaagaagatgcagataccaaacaagtttatttctacctatttaagctcttgagaaagtct
attttacaaagaggaaaacctgtggttgaaggctctttggaaaagaaacccccatttgaa
aaacctagcattgaacagggtgtgaataactttgtacagtacaaatttagtcacctgcca
gcaaaagaaaggcaaacaatagttgagttggcaaaaatgttcctaaaccgcatcaactat
tggcatctggaggcaccatctcaacgaagactgcgatctcccaatgatgatatctccgga
tacaaagagaactacacaaggtggctgtgttactgcaacgtgccacagttctgcgacagt
ctacctcggtacgaaaccacacaggtgtttgggagaacattgcttcgctcggtcttcacc
gtcatgaggcgacaactcctggaacaagcaagacaggaaaaagataaactgcctcttgaa
aaacgaactctaatcctcacccatttcccaaaatttctgtccatgctagaagaagaagtt
tatagtcaaaactctcccatttgggatcaggattttctctcagcctcgtccagaaccagc
cagctaggcatccaaacagttatcagtccacctcctgtggctgggacaatttcatacaat
tcaacctcatcttcccttgagcagtcaaatgcagggagcagcagtcctgcctgcaaagcc
tcttctggacttgaggcaaacccaggagaaaagaggaaaatgactgattctcatgttctg
gaggaggccaagagaccccgagttatgggggatattccgatggaattaatcaacgaggtt
atgtctaccatcacggaccctgcagcgatgcttggaccagagaccaattttctgtcggca
cactcggccagggatgaggcggcaaggttggaagagcgcaggggtgtaattgaatttcac
gtcgttggcaattccctcaaccagaaaccaaacaagaagatcctcatgtggctggttggc
ctacagaacgttttctcccaccagctgccccgaatgccaaaagagtacatcacacggctc
gtctttgacccgaaacacaaaacccttgctttaattaaagatggccgtgttattggtggt
atctgtttccgtatgttcccatctcaaggattcacagagattgtcttctgtgctgtaacc
tccaacgagcaagtcaagggctatggaacacacctaatgaatcatttgaaagaatatcac
ataaagcatgacatcctgaacttcctcacatatgcagatgaatatgcaattggatacttt
aagaaacagggcttctccaaagaaattaaaatacctaaaaccaaatatgttggctacatc
aaggattatgaaggagccactttaatggggtgtgagctaaatccacggatcccatacaca
gaattttctgtcatcattaaaaagcagaaggagataattaaaaaactgattgaaagaaaa
caggcacagattcgaaaagtttaccctggactttcatgttttaaagatggagttcgacag
attcctatagaaagcattcctggaattagagagacaggctggaaaccgagtggaaaagag
aaaagtaaagagcccagagaccctgaccagctttacagcacgctcaagagcatcctccag
caggtgaagagccatcaaagcgcttggcccttcatggaacctgtgaagagaacagaagct
ccgggatattatgaagttataaggttccccatggatctgaaaaccatgagtgaacgcctc
aagaataggtactacgtgtctaagaaattattcatggcagacttacagcgagtctttacc
aattgcaaagagtacaacccccctgagagtgaatactacaaatgtgccaatatcctggag
aaattcttcttcagtaaaattaaggaagctggattaattgacaagtga

DBGET integrated database retrieval system