KEGG   Macaca fascicularis (crab-eating macaque): 102143326Help
Entry
102143326         CDS       T02918                                 

Gene name
KAT6A
Definition
K(lysine) acetyltransferase 6A
Orthology
K11305  
histone acetyltransferase MYST3 [EC:2.3.1.48]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:mcf00001]
 Cellular Processes
  Cellular commiunity
   04550 Signaling pathways regulating pluripotency of stem cells
    102143326 (KAT6A)
Enzymes [BR:mcf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102143326 (KAT6A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
8
AA seq 2003 aa AA seqDB search
MVKLANPLYTEWILEAIKKVKKQKQRPSEERICNAVSSSHGLDRKTVLEQLELSVKDGTI
LKVSNKGLNSYKDPDNPGRIALPKPRNHGKLDNKQNVDWNKLIKRAVEGLAESGGSTLKS
IERFLKGQKDVSALFGGSAASGFHQQLRLAIKRAIGHGRLLKDGPLYRLNTKATNVDGKE
CCESLSCLPPVSLLPHEKDKPVAEPIPICSFCLGTKEQNREKKPEELISCADCGNSGHPS
CLKFSPELTVRVKALRWQCIECKTCSSCRDQGKNADNMLFCDSCDRGFHMECCDPPLTRM
PKGMWICQICRPRKKGRKLLQKKAAQIKRRYANPIGRPKNRLKKQNTVSKGPFSKVRTGP
GRGRKRKMTLSSQSASSSSEEGYLERIDGLDFCRDSSVSLKFNKKTKGLIDGLTKFFTPS
PDGRKARGEVVDYSEQYRIRKRGNRKSSTSDWPTDNQDGWDGKQENEERLFGSQEIMTEK
DMELFRDIQEQALQKVGVTGPPDPQVRCPSVIEFGKYEIHTWYSSPYPQEYSRLPKLYLC
EFCLKYMKSRTILQQHMKKCGWFHPPANEIYRKNNISVFEVDGNVSTIYCQNLCLLAKLF
LDHKTLYYDVEPFLFYVLTQNDVKGCHLVGYFSKEKHCQQKYNVSCIMILPQYQRKGYGR
FLIDFSYLLSKREGQAGSPEKPLSDLGRLSYMAYWKSVILECLYHQNDKQISIKKLSKLT
GICPQDITSTLHHLRMLDFRSDQFVIIRREKLIQDHMAKLQLNLRPVDVDPECLRWTPVI
VSNSVVSEEEEEEAEEGENEEPQCQERELEISVGKSVSRENKEQDSYSVESEKKPEVTAP
VSSTRLNKQVLPRDSLPANSQPSRRGRWGRKNRKTQERFGDKDSKLLLEETSSAPQEQYG
ECEEKSEATQEQYTESEEQLVASQEQLSQDGKPDLPKRRLSEGVEPWRGQLKKSPEALKC
RLTEGNERLPRRYSEGDRAVLRGFSESSEEEEEPESPRSSSPPILTKPTLKRKKPFLHRR
RRVRKRKHHNSSVVTETISETTEVLDEPFEDSDSERPMPRLEPTFEIDEEEEEEDENELF
PREYFHCLSSQDVLRCQSSSKRKSKDEEEDEESDDADDTPILKPVSLLRKRDVKNSPLEP
DTSTPLKKKKGWPKGKSRKPIHWKKRPGRKPGFKLSREIMPVSTQACVIEPVVPIPKAGR
RPKIQESEETVEPKEDMPLTEERKEEEMQAEAEEAEEGEEEDAASSEVPVASPADSSNSP
ETETKEPEVEEEEEKPRVSEEQRQSEEEQQELEEPEPEEEEDAAAETAQNDDHDADDEDD
GHLESTKKKELEEQPTREDVKEEPGVQESFLDANTQKSREKIKDKEETELDSEEEQPSHD
TSVVSEQMPGSEDDHEEDSHTKEELIELKEEEEIPHSELDLETVQAVQSLTQEESNEHES
AYQDCEETLAACQTLQSYTQADEDPQMSMVEDCHASEHNSPISSVQSHPSQSVRSVSSPN
VPALESGYTQISPEQGSLSAPSMQNMETSPMMDVPSVSDHSQQVVDSGFSDLGSIESTTE
NYENPSSYDSTMGGSICGNSSSQSSCSYGGLSSSSSLTQSSCVVTQQMASMGSSCSMMQQ
SSVQPAANCSIKSPQSCVVERPPSNQQQQPPPPPPQQPQPPPPQPQPAPQPPPPQQQPQQ
QPQPQPQQPPPPPPPQQQPPLSQCSMNNSFTPAPMIMEIPESGSTGNISIYERIPGDFGA
GSYSQPSATFSLAKLQQLTNTIMDPHAMPYSHSPAVTSYATSVSLSNTGLAQLAPSHPLA
GTPQAQATMTPPPNLASTTMNLTSPLLQCNMSATNIGIPHTQRLQGQMPVKGHISIRSKS
APLPSAAAHQQQLYGRSPSAVAMQAGPRALAVQRGMNMGVNLMPTPAYNVNSMNMNTLNA
MNSYRMTQPMMNSSYHSNPAYMNQTAQYPMQMQMGMMGSQAYTQQPMQPNPHGNMMYTGP
SHHSYMNAAGVPKQSLNGPYMRR
NT seq 6012 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaactcgcaaacccgctttatactgagtggattttggaggccatcaaaaaagtg
aaaaagcagaaacagcgtccttcagaagaaaggatatgcaatgctgtgtcttcatcccat
ggcttggatcgtaaaactgttttagaacaattggagttgagtgttaaagatggaacgatt
ttaaaagtctcaaataaaggactcaattcctataaagatcctgataatcctgggcgaata
gcacttcctaagcctcggaaccatggaaaattggataataaacaaaatgtggattggaat
aaactgataaagcgggcagttgagggcttggcagagtctggtggctcaactttgaaaagc
attgaacgttttttgaaaggtcagaaggatgtgtctgcgttatttggaggcagtgctgcc
tctggctttcaccagcagttacgattggctatcaaacgtgccattggccatggcagactc
cttaaagatggacctctttatcggctcaacactaaagcaaccaatgtggatgggaaagag
tgttgtgagtctctttcctgtttacctccagtgtcccttcttccacatgaaaaggataag
ccggttgctgaaccaatccccatctgtagtttctgtcttggtacaaaagaacaaaaccga
gaaaagaagccagaggaactcatctcctgtgccgattgtggcaacagtggccatccatcc
tgtttaaagttttcccctgaactaacggttcgagtgaaggccttacggtggcagtgcatt
gagtgtaaaacgtgcagctcctgtcgagatcaaggcaaaaatgcggataacatgctcttt
tgtgattcgtgtgaccgaggttttcacatggagtgttgtgatccaccactcacccgtatg
ccaaaaggcatgtggatatgtcaaatatgtcgacctaggaaaaaaggacgaaaacttcta
caaaagaaggcagcacagataaaacggcgttatgctaatccaataggacgtccaaaaaac
aggttaaagaaacaaaacacggtatcaaaaggtcccttcagcaaagttcgaactggccct
ggaaggggtaggaaacgaaaaatgactctttccagccaatcagcatcatcatcatcagaa
gaaggatatttagaacggatagatggcttggacttctgcagagatagcagtgtctccttg
aagttcaacaagaaaaccaaagggctcattgatggccttaccaaattttttaccccttcc
cctgatggtcggaaagctcgtggggaagtggtggactactctgagcaatatcgaatcaga
aagaggggcaacaggaaatcaagcacttcagattggcccacagacaatcaggatggctgg
gatggcaaacaagaaaatgaggagcgactttttgggagccaggaaatcatgactgagaaa
gatatggaattatttcgtgatatccaagaacaagcactgcagaaagttggagtgactggt
ccccctgatccacaagtccgctgtccctctgtcattgagtttgggaagtatgaaattcac
acctggtactcctccccatatcctcaagaatactcaaggcttcccaaattgtatctttgt
gaattttgtctaaaatatatgaaaagtagaactattctgcagcagcacatgaagaaatgt
ggttggttccatcctcctgccaatgagatttacagaaagaataatatttctgtctttgag
gttgatgggaatgtgagtaccatttattgtcaaaacctgtgtctcttggcaaagttgttt
cttgaccacaaaaccctctattatgatgtggagccatttcttttttatgtactaacacag
aatgatgtcaagggctgccaccttgttggctacttttctaaagaaaagcactgccaacag
aagtacaatgtttcctgtataatgattcttcctcaataccagcgtaagggctatggcagg
tttctcatcgatttcagttatttgttatcaaagcgtgaaggccaagcagggtctccagag
aaaccattatccgatctgggtcgtctttcctacatggcatattggaaaagtgtaatattg
gagtgcctttatcaccaaaatgacaagcagatcagcattaagaaattaagcaagttaact
ggaatctgccctcaagacatcacttccacactccaccacctacgaatgctggacttccgt
agtgaccaatttgtgattatccgccgggaaaaacttatccaggatcacatggcaaagctt
cagctgaatttgcgacctgtagatgtagatccagaatgtttgcgctggactccagtcata
gtgtccaactctgtggtctcagaggaagaagaagaggaggctgaggaaggagaaaacgaa
gagccacagtgccaggaaagagaattagagatcagtgtgggaaagtctgtgtctcgtgag
aacaaagaacaagattcttattcagtagaaagtgaaaagaaaccagaagttacggctcca
gtcagttctacacgtttgaacaaacaagtccttcctcgtgatagtcttcctgcaaatagc
cagccatctcggaggggccgctgggggaggaagaacagaaaaacccaggaacgcttcggt
gataaagattctaaactgctcttggaagagacgtcttcagctcctcaggaacaatatgga
gaatgtgaggagaaatcagaagccacccaggaacaatacactgaaagtgaagaacagctg
gtggcctctcaggagcagctaagccaggatgggaaacctgaccttcccaaaagaagactc
agtgagggggttgagccctggcgaggacagctcaagaaaagccctgaggctctgaagtgc
agattaacagaaggaaatgagaggctgccccgccgctacagtgaaggtgacagggctgtc
ctcaggggcttcagtgagagcagcgaggaggaggaagagccggaaagccctcggtcaagc
tcgccaccaattctcacaaagcccacgctgaagcgaaagaaaccatttctccaccgaagg
aggagagtccgaaagcgcaaacaccacaatagcagtgtagtcacggaaactatttctgag
accactgaagtgttagatgaaccttttgaagattctgactccgagaggccaatgccaaga
ttagaacccacatttgagatcgatgaagaagaggaggaagaggatgaaaatgaacttttc
cctagagaatacttccattgtttgtcttcgcaggatgtactcaggtgtcagtcctcttct
aagaggaagtctaaagatgaagaagaagatgaagagtcagatgatgctgatgacactcct
atcctaaagccagtatctctcttgcgaaaacgtgatgtgaagaattctcctcttgagcca
gatacatccacacctttgaaaaagaaaaagggatggcccaaaggcaagagtcgcaaacca
atccactggaagaaaagacctggtcgaaaaccaggatttaagttgagtcgggaaatcatg
ccagtttctactcaagcatgcgtcattgagcccgttgtccccattcctaaagctggacgt
agacccaagatccaggagagtgaagaaactgttgagccaaaagaagacatgcccctaacc
gaggagaggaaggaggaggagatgcaagcagaggcagaagaagctgaagagggtgaggaa
gaggatgcagccagcagtgaagtcccagtagcctctccagcagacagcagcaatagtcct
gagaccgaaactaaggagcccgaggtggaggaggaagaagagaagccccgtgtctcagag
gagcagaggcagtcagaggaggagcagcaggaattagaggagccagaaccagaggaggag
gaggatgcagctgcagagactgcccagaatgatgaccacgatgctgatgatgaggatgat
ggccacctggagtccacaaagaaaaaggagctggaggaacagcccacaagggaagatgtc
aaggaggagcctggtgttcaagagtcttttttagatgctaatacgcagaagagtagggaa
aagataaaggataaagaggaaactgagctggattccgaagaggagcaaccttcccatgac
acgtccgtggtgtcagagcagatgcctgggtctgaggacgaccacgaagaagactcccac
actaaggaagagttaatcgaattaaaagaggaggaagagattcctcatagtgaactggat
ctggaaactgtacaggcagtgcagtctttgactcaagaagaaagcaatgagcatgagagc
gcctaccaggactgtgaggaaactctcgcagcatgtcagactctgcagagttatacccag
gctgatgaggatcctcagatgtccatggttgaagactgtcatgcatcagaacataacagc
cctatctcctctgttcagtctcaccccagccagtcagtccgttcagtcagcagtcccaac
gtgcctgcccttgagagtggctacacccagatcagcccggaacaaggatccctgtccgca
ccctctatgcagaacatggagaccagccccatgatggatgtgccttccgtatcagaccac
tctcagcaggtggtggacagcggcttcagtgacctgggcagcattgagagcaccactgaa
aactatgagaacccgagcagttatgactccacgatgggcggcagcatctgtgggaacagc
tcttcccaaagcagctgctcctacggtgggctgtcgtcctccagcagcctcacccagagc
agctgtgtggtcactcagcagatggccagcatgggcagcagctgcagcatgatgcagcag
agcagtgtccagcctgctgccaactgcagcatcaaatcacctcagagctgtgtggtggag
aggcctcccagtaaccagcagcagcagccaccgccaccacctccacagcagccgcagcca
ccgccgccacaaccacaaccagcaccacagcctccaccaccccagcagcagccacagcag
cagccgcagcctcagccccagcagcctccgcccccaccccctccccagcagcagcccccg
ctgtcacagtgtagtatgaataacagtttcaccccagctcctatgatcatggagatacca
gaatctggaagcactgggaacataagtatctatgagaggattccaggggattttggtgct
ggcagctactctcaaccatcagccaccttcagcctagccaagctgcagcagctgaccaac
accattatggaccctcatgccatgccttatagccattctcctgctgtgacttcctatgca
accagtgtttctctgtccaatacaggactggctcagctggctccgtctcatcccttagct
gggactcctcaagcacaagccaccatgacgccacccccaaacttggcatccactaccatg
aacctcacgtctcctctgctccagtgcaacatgtctgccaccaacattggcattcctcac
acgcagagattgcaagggcaaatgccagtgaaggggcacatttccatccgctccaagtct
gcaccactgccctctgcggctgctcaccagcagcagctgtatggccgcagcccgtcggca
gttgccatgcaggctggccctcgtgcactggctgttcagcgtggcatgaacatgggggtt
aatctgatgcctacccccgcctataatgtcaattccatgaatatgaacaccttgaatgcc
atgaacagctatcgaatgacacagcccatgatgaacagcagttaccatagtaaccctgcc
tacatgaaccagacagcacagtatcctatgcagatgcagatgggaatgatggggagccag
gcctatacccagcagcctatgcagccaaaccctcatgggaacatgatgtacacgggcccc
tcccatcacagctacatgaacgctgctggcgtgcccaagcagtcactcaatggaccttac
atgagaagatga

DBGET integrated database retrieval system