KEGG   Macaca fascicularis (crab-eating macaque): 102143626Help
Entry
102143626         CDS       T02918                                 

Gene name
ACHE
Definition
(RefSeq) acetylcholinesterase (Cartwright blood group)
  KO
K01049  
acetylcholinesterase [EC:3.1.1.7]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
Glycerophospholipid metabolism
Cholinergic synapse
Brite
KEGG Orthology (KO) [BR:mcf00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    102143626 (ACHE)
 Organismal Systems
  Nervous system
   04725 Cholinergic synapse
    102143626 (ACHE)
Enzymes [BR:mcf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.7  acetylcholinesterase
     102143626 (ACHE)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcf00537]
 Enzymes
  102143626 (ACHE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
3
AA seq 681 aa AA seqDB search
MACVLVSACLLPSLPVSPHLCQPAPPPLQLSDNPWADHVLISSLLASRPTFHPFPFFLPA
DTACPAAMRPPQCPLHTPSLASPLLLLLLWLLGGGVGAEGREDAELLVTVRGGRLRGIRL
KTPGGPVSAFLGIPFAEPPTGPRRFLPPEPKQPWSGVVDATTFQSVCYQYVDTLYPGFEG
TEMWNPNRELSEDCLYLNVWTPYPRPTSPTPVLVWIYGGGFYSGASSLDVYDGRFLVQAE
RTVLVSMNYRVGAFGFLALPGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSVTLFGE
SAGAASVGMHLLSPPSRGLFHRAVLQSGAPNGPWATVGMGEARRRATQLAHLVGCPPGGT
GGNDTELVACLRTRPAQVLVNNEWHVLPQESVFRFSFVPVVDGDFLSDTPEALINAGDFH
GLQVLVGVVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEAVVLHY
TDWLHPEDPARLREALSDVVGDHNVVCPVAQLAGRLAAQGARVYAYVFEHRASTLSWPLW
MGVPHGYEIEFIFGIPLDPSRNYTTEEKIFAQRLMRYWANFARTGDPNEPRDPKGPQWPP
YTAGAQQYVSLDLRPLEVRRGLRAQACAFWNRFLPKLLSATDTLDEAERQWKAEFHRWSS
YMVHWKNQFDHYSKQDRCSDL
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atggcctgtgtccttgtctctgcctgtctccttccctccctccctgtctcccctcatctt
tgccaacctgccccacctcctctgcagctgagcgataacccttgggccgaccatgtccta
atctcctccctcctggcttctcgaccgacctttcaccctttccctttctttctcccagca
gacaccgcctgccctgcagccatgaggcccccgcagtgtcccctgcacacgccttccctg
gcttccccactccttctcctccttctctggctcctgggaggaggagtgggggctgagggc
cgggaggatgcagagctgctggtgactgtgcgtgggggccggctgcggggcattcgtctg
aagacccccgggggccccgtctctgctttcctgggcatcccctttgcggagccacccacg
ggacctcgtcgctttctgccaccggagcccaagcagccttggtcaggggtggtagatgct
acaaccttccagagtgtctgctaccagtatgtggataccttatacccaggttttgagggc
accgagatgtggaaccccaaccgtgagctgagtgaggactgcctctacctcaacgtgtgg
acaccatacccccggcctacatcccccacccctgttctcgtctggatctatgggggtggc
ttctacagtggggcctcctccttagacgtctatgatggccgcttcttggtacaggccgag
aggactgtgctggtgtccatgaactaccgggtgggagcctttggcttcctggccctgccc
gggagccgagaggccccggggaatgtgggtctcctggatcagaggctggccctgcagtgg
gtgcaggagaacgtggcagccttcgggggggacccgacatcagtgacgctgtttggggag
agtgcgggtgctgcctcagtgggcatgcatctgctgtccccgcccagccggggtctgttc
cacagggccgtgctgcaaagcggtgcccccaatggaccctgggccacggtgggcatggga
gaggcccgccgcagggccacacagctggcccaccttgtgggctgtcccccaggcggcact
ggtgggaatgacacagagctagtagcctgccttcggacacgaccagcgcaggtcctggtg
aacaatgaatggcatgtgctgcctcaagaaagcgtcttccggttctccttcgtacctgtg
gtagatggagacttcctcagtgacaccccagaggcccttatcaacgcgggagacttccac
ggcctgcaggtgctggtgggtgtggtgaaggatgagggctcatattttctggtttacggg
gccccaggcttcagcaaagacaacgagtctctcatcagccgggccgagttcctggccggg
gtgcgggtcggggtcccccaggtaagtgacctggcagccgaggctgtggtcctgcattac
acagactggctgcatcccgaggacccggcacgcctgagggaggccctgagcgatgtggtg
ggcgaccacaatgtcgtgtgccccgtggcccagctggctgggcgactggctgcccagggt
gcccgggtctacgcctacgtcttcgaacaccgtgcctccacgctctcctggcccctgtgg
atgggggtgccccacggctacgagatcgagttcatctttgggatccccctggacccttct
cgaaactacaccacggaggagaaaatcttcgcccagcgactcatgcgatactgggccaac
ttcgcccgcacaggggaccccaatgagccccgagaccccaagggcccgcaatggcccccg
tacacggcgggggctcagcagtacgtgagtctcgacctgcggccgctggaggtgcggcgg
gggctgcgcgcccaggcctgcgccttctggaaccgtttcctccccaaattgctcagcgcc
accgacacgctcgacgaggcggagcgccagtggaaggccgagttccaccgctggagctcc
tacatggtgcactggaagaaccagttcgaccactacagcaagcaggatcgctgctcagac
ctgtga

DBGET integrated database retrieval system