KEGG   Macaca fascicularis (crab-eating macaque): 102145890Help
Entry
102145890         CDS       T02918                                 

Gene name
NCOA3
Definition
nuclear receptor coactivator 3
Orthology
K11256  
nuclear receptor coactivator 3 [EC:2.3.1.48]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
Thyroid hormone signaling pathway
Brite
KEGG Orthology (KO) [BR:mcf00001]
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    102145890 (NCOA3)
Enzymes [BR:mcf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102145890 (NCOA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
10
AA seq 1420 aa AA seqDB search
MSGLGENLDPLATDSRKHKLPCDAPGQGLTCSGEKRRREQESKYIEELAELISANLSDID
NFNVKPDKCAILKETVRQIRQIKEQGKTISNDDDVQKADVSSTGQGVIDKDSLGPLLLQA
LDGFLFVVNRDGNIVFVSENVTQYLQYKQEDLVNTSVYNILHEEDRKDFLKNLPKSTVNG
VSWTNETQRQKSHTFNCRMLMKTPHDILEDVNASPEMRQRYETMQCFALSQPRAMMEEGD
DLQSCMICVARRITTGERAFPSNPESFITRHDLSGKVVNIDTNSLRSSMRPGFEDIIRRC
IQRFFSLNDGQSWSQKRHYQEAYLNGHAETPVYRFSLADGTIVTAQTKSKLFRNPVTNDR
HGFVSTHFLQREQNGYRPNPNPVGQGIRPPMAGCNSSVGSMSMSPNQGLQMPSSRAYGLA
DPSTTGQMSGARYGGSSNIASLTAGPGMQSPSSYQNNNYGLSMSSPPHGSPGLAPNQQNI
MISPRNRGSPKIASHQFSPVAGVHSPMGSSGNSGNHSFSSSSLSALQAISEGVGTSLLST
LSSPGPKLDNSPNMNITQPSKVSNQDSKSPLGFYCDQNPVESSMCQSNSRDHLSDKESKE
SSVEGSENQRGPLESKGHKKLLQLLTCSSDDRGHSSLTNSPLDSSCKESSVSVTSPSGVS
SSTSGGVSSTSNMHGSLLQEKHRILHKLLQNGNSPAEVAKITAEATGKDTSSITSCGDGN
VVKQEQLSPKKKENNALLRYLLDRDDPSDALSKELQPQVEGVDNKISQCTSSTIPSSSQE
KDPKIKTETSEEGSGDLDNLDAILGDLTSSDFYNNSISSNGSHLGTKQQVFQGTNSVGLK
SPQSVQSIRPPYNRAVSLDSPVSVGSSPPVKNISAFPMLPKQPMLGGNPRMMDSQENYGS
SMGGPNRNVTVTQTPSSGDWGLPNSKASRMEPMNSNSMGRPGGDYNTSLPRPAVGGSMPT
LPLRSNSIPGARPILQPQQQQQMLQMRPGELPMGMGANPYGQAAASNQLGSWPDGMLSIE
QVPHGTQNRPLLRNSLDDIVGPPSNLEGQSDERALLDQLHTLLSNTDATGLEEIDRALGI
PELVNQGQALEPKQDAFQGQEAAVMMDQKAGLYGQTYPAQGPPMQGGFHLQGQSPSFNSM
MNQMNQQGNFPLQGMHPRANIMRPRTNTPKQLRMQLQQRLQGQQFLNQSRQALELKMENP
TAGGAAVMRPMMQPQQGFLNAQMVAQRSRELLSHHFRQQRVAMMMQQQQQQQQQQQQQQQ
QQQQQQQQQQQQTQAFSPPPNVTASPSMDGLLAGPAMPQAPPQQFPYQPNYGMGQQPDPA
FGRVSSPPSAMISSRMGPSQNPMMQHPQAASIYQSSEMKGWPSGNLARNSSFSQQQFAHQ
GNPAVYSMVHMNGSSGHMGQMNMNPMPMSGMPMGPDQKYC
NT seq 4263 nt NT seq  +upstreamnt  +downstreamnt
atgagtggattaggagaaaacttggatccactggccactgattcacgaaaacacaaattg
ccatgtgatgctccaggacaaggtcttacctgcagtggtgaaaagcggagacgggagcag
gaaagtaaatatattgaagaattggctgagctgatatctgccaatcttagtgatattgac
aatttcaatgtcaaaccagataaatgtgcgattttgaaggaaacagtaagacagatacgt
caaataaaagaacaaggaaaaactatttccaatgatgatgatgttcaaaaagccgatgta
tcttctacagggcagggagttattgataaagactccttaggaccgcttttacttcaggca
ttggatggtttcctatttgtggtgaatcgagatggaaacattgtatttgtgtcagaaaat
gtcacacaatacctgcaatataagcaagaggacctggttaacacaagtgtttacaatatc
ttacatgaagaagacagaaaggattttcttaaaaatttaccaaaatctacagttaatgga
gtttcctggacaaatgagacccagagacaaaaaagccatacatttaattgccgtatgttg
atgaaaacaccacatgatattctggaagacgtaaacgccagtcctgaaatgcgccagaga
tacgaaaccatgcagtgctttgccctgtctcagccacgagctatgatggaggaaggggac
gatttgcaatcttgtatgatctgtgtggcacgccgcattactacaggtgaaagagcattt
ccatcaaaccctgagagctttattaccagacatgatctttcagggaaggttgtcaatata
gatacaaattcactaagatcctccatgaggcctggctttgaagatataatccgaaggtgt
attcagagattttttagtctaaatgatgggcagtcatggtcccagaaacgtcactatcaa
gaagcttatcttaatggccatgcagaaaccccagtatatcgattctcgttggctgatgga
actatagtgactgcacagacaaaaagcaaactcttccgaaatcctgtaacaaatgatcga
catggctttgtctcaacccactttcttcagagagaacagaatggatatagaccaaaccca
aatcctgttggacaagggattagaccacctatggctggatgcaacagttcagtaggcagc
atgagtatgtcgccaaaccaaggcttacagatgccgagcagcagggcctatggcttggca
gaccctagcaccacagggcagatgagtggagctaggtatgggggttccagtaacatagcc
tcattgaccgctgggccaggcatgcaatcaccatcttcctaccagaacaacaactatggg
ctcagcatgagtagccccccacatggaagtcctggtcttgccccaaaccagcagaatatc
atgatttctcctcgtaatcgtgggagtccaaagatagcctcacatcagttttctcctgtt
gcaggtgtgcactctcccatgggatcttctggcaatagtgggaaccacagcttttccagc
agctctctcagtgccctgcaagccatcagtgagggtgtagggacttctcttttatctact
ctgtcatcaccaggccccaaattggataactctcccaatatgaatataacccaaccaagt
aaagtaagcaatcaggattccaagagtccgctgggcttttattgcgaccaaaatccagtg
gagagttcaatgtgtcagtcaaatagcagagatcacctcagtgacaaagaaagtaaggag
agcagtgttgaggggtcagagaatcaaaggggtcctttggaaagcaaaggtcacaaaaaa
ttactgcagttacttacctgttcttctgatgaccggggtcattcctccttgaccaactcc
ccgctagattcaagttgtaaagaatcttctgttagtgtcaccagcccctctggagtctcc
tcctctacatctggaggagtatcctctacatccaatatgcatgggtcactgttacaagag
aagcaccggattttgcacaagttgctgcagaatgggaattcaccagctgaagtagccaag
attactgcagaagccactgggaaagacaccagcagtataacttcttgtggggacggaaat
gttgtcaagcaggagcagctaagtcctaagaagaaggagaataatgcacttcttagatat
ctgctggacagggatgatcctagtgatgcactctctaaagaactacagccccaagtggaa
ggagtggataataaaataagtcagtgcaccagctccaccattcctagctcaagtcaagag
aaagaccctaaaattaagacagagacaagtgaagagggatctggagacttggataatcta
gatgctattcttggtgatctgactagttctgacttttacaataattccatatcctcaaat
ggtagtcatctggggactaagcaacaggtgtttcaaggaactaattctgtgggtttgaaa
agtccacagtctgtgcagtctattcgtcctccatataaccgagcagtgtctctggatagt
cctgtttctgttggctcaagtcctccagtgaaaaatatcagtgctttccccatgttacca
aagcaacccatgttgggtgggaatccaagaatgatggatagtcaggaaaattatggctca
agtatgggtggaccaaacagaaatgtgactgtgactcagactccttcctcaggagactgg
ggcttaccaaactcaaaggccagcagaatggaacctatgaattcaaactccatgggaaga
ccaggaggagattataatacttctttacccagacctgcagtgggtggctctatgcccacg
ttgcctcttcggtctaatagcataccaggtgcaagaccaatattgcagccgcagcaacag
caacagatgcttcaaatgaggcctggtgaactccccatgggaatgggggctaatccctat
ggccaagcagcagcatctaaccaactgggttcctggcccgatggcatgttgtcaatagaa
caagttcctcatggcactcaaaataggccccttcttaggaattccctggatgatattgtc
gggccaccttccaacctggaaggccagagtgatgaaagagcattattggaccagctgcac
actcttctcagcaacacagatgccacaggcctggaagaaattgacagagctttgggaatc
cctgaacttgtcaatcagggacaggcattagaacccaaacaggatgctttccaaggccaa
gaagcagcagtaatgatggatcagaaggcaggattatatggacagacgtacccagcacag
gggcctccaatgcaaggaggctttcatcttcagggacaatcaccatcttttaactctatg
atgaatcagatgaaccagcaaggcaattttcctctccaaggaatgcacccgcgagccaac
atcatgagaccccggacaaacacccccaagcaacttagaatgcagcttcagcagaggctg
cagggccagcagtttttgaatcagagcagacaggcacttgaattgaaaatggaaaaccct
actgctggtggtgctgccgtgatgaggcctatgatgcagccccagcagggttttcttaat
gctcaaatggtcgcccaacgcagcagagagctgctaagtcatcacttccgacaacagagg
gtggctatgatgatgcagcagcagcagcagcagcagcaacaacagcaacagcagcagcag
cagcagcagcagcagcagcagcagcagcagcagcaaacccaggccttcagcccacctcct
aatgtgactgcttcccccagcatggatgggcttttggcgggacctgcaatgccacaagct
ccgccgcaacagtttccatatcaaccaaattatggaatgggacaacaaccagatccagcc
tttggtcgagtgtctagtcctcccagtgcaatgatatcgtcaagaatgggtccctcccag
aatcccatgatgcaacacccccaggctgcatccatctatcagtcctcagaaatgaagggc
tggccatcaggaaatttggccaggaacagctccttttcccagcagcagtttgcccaccag
gggaatcccgcagtgtatagtatggtacacatgaatggcagcagtggtcacatgggacag
atgaacatgaaccccatgcccatgtctggcatgcctatgggccctgatcagaaatactgc
tga

DBGET integrated database retrieval system