KEGG   Macaca fascicularis (crab-eating macaque): 102145890Help
Entry
102145890         CDS       T02918                                 

Gene name
NCOA3
Definition
(RefSeq) nuclear receptor coactivator 3
  KO
K11256  
nuclear receptor coactivator 3 [EC:2.3.1.48]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
Endocrine resistance
Thyroid hormone signaling pathway
Pathways in cancer
Breast cancer
Brite
KEGG Orthology (KO) [BR:mcf00001]
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    102145890 (NCOA3)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    102145890 (NCOA3)
   05224 Breast cancer
    102145890 (NCOA3)
  Drug resistance
   01522 Endocrine resistance
    102145890 (NCOA3)
Enzymes [BR:mcf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102145890 (NCOA3)
Chromosome [BR:mcf03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    102145890 (NCOA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
10
AA seq 1420 aa AA seqDB search
MSGLGENLDPLATDSRKHKLPCDAPGQGLTCSGEKRRREQESKYIEELAELISANLSDID
NFNVKPDKCAILKETVRQIRQIKEQGKTISNDDDVQKADVSSTGQGVIDKDSLGPLLLQA
LDGFLFVVNRDGNIVFVSENVTQYLQYKQEDLVNTSVYNILHEEDRKDFLKNLPKSTVNG
VSWTNETQRQKSHTFNCRMLMKTPHDILEDVNASPEMRQRYETMQCFALSQPRAMMEEGD
DLQSCMICVARRITTGERAFPSNPESFITRHDLSGKVVNIDTNSLRSSMRPGFEDIIRRC
IQRFFSLNDGQSWSQKRHYQEAYLNGHAETPVYRFSLADGTIVTAQTKSKLFRNPVTNDR
HGFVSTHFLQREQNGYRPNPNPVGQGIRPPMAGCNSSVGSMSMSPNQGLQMPSSRAYGLA
DPSTTGQMSGARYGGSSNIASLTAGPGMQSPSSYQNNNYGLSMSSPPHGSPGLAPNQQNI
MISPRNRGSPKIASHQFSPVAGVHSPMGSSGNSGNHSFSSSSLSALQAISEGVGTSLLST
LSSPGPKLDNSPNMNITQPSKVSNQDSKSPLGFYCDQNPVESSMCQSNSRDHLSDKESKE
SSVEGSENQRGPLESKGHKKLLQLLTCSSDDRGHSSLTNSPLDSSCKESSVSVTSPSGVS
SSTSGGVSSTSNMHGSLLQEKHRILHKLLQNGNSPAEVAKITAEATGKDTSSITSCGDGN
VVKQEQLSPKKKENNALLRYLLDRDDPSDALSKELQPQVEGVDNKISQCTSSTIPSSSQE
KDPKIKTETSEEGSGDLDNLDAILGDLTSSDFYNNSISSNGSHLGTKQQVFQGTNSVGLK
SPQSVQSIRPPYNRAVSLDSPVSVGSSPPVKNISAFPMLPKQPMLGGNPRMMDSQENYGS
SMGGPNRNVTVTQTPSSGDWGLPNSKASRMEPMNSNSMGRPGGDYNTSLPRPAVGGSMPT
LPLRSNSIPGARPILQPQQQQQMLQMRPGELPMGMGANPYGQAAASNQLGSWPDGMLSIE
QVPHGTQNRPLLRNSLDDIVGPPSNLEGQSDERALLDQLHTLLSNTDATGLEEIDRALGI
PELVNQGQALEPKQDAFQGQEAAVMMDQKAGLYGQTYPAQGPPMQGGFHLQGQSPSFNSM
MNQMNQQGNFPLQGMHPRANIMRPRTNTPKQLRMQLQQRLQGQQFLNQSRQALELKMENP
TAGGAAVMRPMMQPQQGFLNAQMVAQRSRELLSHHFRQQRVAMMMQQQQQQQQQQQQQQQ
QQQQQQQQQQQQTQAFSPPPNVTASPSMDGLLAGPAMPQAPPQQFPYQPNYGMGQQPDPA
FGRVSSPPSAMISSRMGPSQNPMMQHPQAASIYQSSEMKGWPSGNLARNSSFSQQQFAHQ
GNPAVYSMVHMNGSSGHMGQMNMNPMPMSGMPMGPDQKYC
NT seq 4263 nt NT seq  +upstreamnt  +downstreamnt
atgagtggattaggagaaaacttggatccactggccactgattcacgaaaacacaaattg
ccatgtgatgctccaggacaaggtcttacctgcagtggtgaaaagcggagacgggagcag
gaaagtaaatatattgaagaattggctgagctgatatctgccaatcttagtgatattgac
aatttcaatgtcaaaccagataaatgtgcgattttgaaggaaacagtaagacagatacgt
caaataaaagaacaaggaaaaactatttccaatgatgatgatgttcaaaaagccgatgta
tcttctacagggcagggagttattgataaagactccttaggaccgcttttacttcaggca
ttggatggtttcctatttgtggtgaatcgagatggaaacattgtatttgtgtcagaaaat
gtcacacaatacctgcaatataagcaagaggacctggttaacacaagtgtttacaatatc
ttacatgaagaagacagaaaggattttcttaaaaatttaccaaaatctacagttaatgga
gtttcctggacaaatgagacccagagacaaaaaagccatacatttaattgccgtatgttg
atgaaaacaccacatgatattctggaagacgtaaacgccagtcctgaaatgcgccagaga
tacgaaaccatgcagtgctttgccctgtctcagccacgagctatgatggaggaaggggac
gatttgcaatcttgtatgatctgtgtggcacgccgcattactacaggtgaaagagcattt
ccatcaaaccctgagagctttattaccagacatgatctttcagggaaggttgtcaatata
gatacaaattcactaagatcctccatgaggcctggctttgaagatataatccgaaggtgt
attcagagattttttagtctaaatgatgggcagtcatggtcccagaaacgtcactatcaa
gaagcttatcttaatggccatgcagaaaccccagtatatcgattctcgttggctgatgga
actatagtgactgcacagacaaaaagcaaactcttccgaaatcctgtaacaaatgatcga
catggctttgtctcaacccactttcttcagagagaacagaatggatatagaccaaaccca
aatcctgttggacaagggattagaccacctatggctggatgcaacagttcagtaggcagc
atgagtatgtcgccaaaccaaggcttacagatgccgagcagcagggcctatggcttggca
gaccctagcaccacagggcagatgagtggagctaggtatgggggttccagtaacatagcc
tcattgaccgctgggccaggcatgcaatcaccatcttcctaccagaacaacaactatggg
ctcagcatgagtagccccccacatggaagtcctggtcttgccccaaaccagcagaatatc
atgatttctcctcgtaatcgtgggagtccaaagatagcctcacatcagttttctcctgtt
gcaggtgtgcactctcccatgggatcttctggcaatagtgggaaccacagcttttccagc
agctctctcagtgccctgcaagccatcagtgagggtgtagggacttctcttttatctact
ctgtcatcaccaggccccaaattggataactctcccaatatgaatataacccaaccaagt
aaagtaagcaatcaggattccaagagtccgctgggcttttattgcgaccaaaatccagtg
gagagttcaatgtgtcagtcaaatagcagagatcacctcagtgacaaagaaagtaaggag
agcagtgttgaggggtcagagaatcaaaggggtcctttggaaagcaaaggtcacaaaaaa
ttactgcagttacttacctgttcttctgatgaccggggtcattcctccttgaccaactcc
ccgctagattcaagttgtaaagaatcttctgttagtgtcaccagcccctctggagtctcc
tcctctacatctggaggagtatcctctacatccaatatgcatgggtcactgttacaagag
aagcaccggattttgcacaagttgctgcagaatgggaattcaccagctgaagtagccaag
attactgcagaagccactgggaaagacaccagcagtataacttcttgtggggacggaaat
gttgtcaagcaggagcagctaagtcctaagaagaaggagaataatgcacttcttagatat
ctgctggacagggatgatcctagtgatgcactctctaaagaactacagccccaagtggaa
ggagtggataataaaataagtcagtgcaccagctccaccattcctagctcaagtcaagag
aaagaccctaaaattaagacagagacaagtgaagagggatctggagacttggataatcta
gatgctattcttggtgatctgactagttctgacttttacaataattccatatcctcaaat
ggtagtcatctggggactaagcaacaggtgtttcaaggaactaattctgtgggtttgaaa
agtccacagtctgtgcagtctattcgtcctccatataaccgagcagtgtctctggatagt
cctgtttctgttggctcaagtcctccagtgaaaaatatcagtgctttccccatgttacca
aagcaacccatgttgggtgggaatccaagaatgatggatagtcaggaaaattatggctca
agtatgggtggaccaaacagaaatgtgactgtgactcagactccttcctcaggagactgg
ggcttaccaaactcaaaggccagcagaatggaacctatgaattcaaactccatgggaaga
ccaggaggagattataatacttctttacccagacctgcagtgggtggctctatgcccacg
ttgcctcttcggtctaatagcataccaggtgcaagaccaatattgcagccgcagcaacag
caacagatgcttcaaatgaggcctggtgaactccccatgggaatgggggctaatccctat
ggccaagcagcagcatctaaccaactgggttcctggcccgatggcatgttgtcaatagaa
caagttcctcatggcactcaaaataggccccttcttaggaattccctggatgatattgtc
gggccaccttccaacctggaaggccagagtgatgaaagagcattattggaccagctgcac
actcttctcagcaacacagatgccacaggcctggaagaaattgacagagctttgggaatc
cctgaacttgtcaatcagggacaggcattagaacccaaacaggatgctttccaaggccaa
gaagcagcagtaatgatggatcagaaggcaggattatatggacagacgtacccagcacag
gggcctccaatgcaaggaggctttcatcttcagggacaatcaccatcttttaactctatg
atgaatcagatgaaccagcaaggcaattttcctctccaaggaatgcacccgcgagccaac
atcatgagaccccggacaaacacccccaagcaacttagaatgcagcttcagcagaggctg
cagggccagcagtttttgaatcagagcagacaggcacttgaattgaaaatggaaaaccct
actgctggtggtgctgccgtgatgaggcctatgatgcagccccagcagggttttcttaat
gctcaaatggtcgcccaacgcagcagagagctgctaagtcatcacttccgacaacagagg
gtggctatgatgatgcagcagcagcagcagcagcagcaacaacagcaacagcagcagcag
cagcagcagcagcagcagcagcagcagcagcagcaaacccaggccttcagcccacctcct
aatgtgactgcttcccccagcatggatgggcttttggcgggacctgcaatgccacaagct
ccgccgcaacagtttccatatcaaccaaattatggaatgggacaacaaccagatccagcc
tttggtcgagtgtctagtcctcccagtgcaatgatatcgtcaagaatgggtccctcccag
aatcccatgatgcaacacccccaggctgcatccatctatcagtcctcagaaatgaagggc
tggccatcaggaaatttggccaggaacagctccttttcccagcagcagtttgcccaccag
gggaatcccgcagtgtatagtatggtacacatgaatggcagcagtggtcacatgggacag
atgaacatgaaccccatgcccatgtctggcatgcctatgggccctgatcagaaatactgc
tga

DBGET integrated database retrieval system