KEGG   Macaca fascicularis (crab-eating macaque): 102146254Help
Entry
102146254         CDS       T02918                                 

Gene name
ALDH1L1
Definition
aldehyde dehydrogenase 1 family, member L1
Orthology
K00289  
formyltetrahydrofolate dehydrogenase [EC:1.5.1.6]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
One carbon pool by folate
Class
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:mcf00670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 904 aa AA seqDB search
MKIAVIGQSLFGQEVYGHLRKEGHEVVGVFTVPDKDGKADPLGLEAEKDGVPVFKFSRWR
AKGQALPEVVAKYQALGAELNVLPFCSQFIPMEIINAPRHGSIIYHPSLLPRHRGASAIN
WTLIHGDKKGGFSIFWADDGLDTGDLLLQKECEVLPDDTVSTLYNRFLFPEGIKGMVQAV
RLIAEGKAPRLPQPEEGATYEGIQKKETAKIDWDQPAEAIHNWIRGNDKVPGAWTEACEP
LQKLTFFNSTLNTSGLVPEGDALPIPGAHRPGVVTKAGLILFGNDDKMLLVKNIQLEDGK
MILASNFFKGAASSALELTEAELVTAEAVRSAWQRILPNVLEVEDSTDFFKSGAASVDVV
RLVEEVKELCDGLELENEDVYMATTFGDFIQLLVRKLRGDDEEGECSIDYVEMAVNKRTL
HMPHQLFIGGAFVDAEGAKTFETINPTDGSVICQVSLAQVTDVDKAVATAKDAFENGRWG
KISARDRGRLLYRLADLMEQHQEELATIEALDAGAVYTLALKTHVGMSIQTFRYFAGWCD
KIQGSTIPINQARPNRNLTLTRKEPVGVCGIIIPWNYPLMMLSWKTAACLAAGNTVVIKP
AQVTPLTALKFAELTLKAGIPKGVVNVLPGSGSLIGQRLSDHPDVRKIGFTGSTEVGKHI
MKSCAISNVKKVSLELGGKSPLIIFADCDLNKAVQMGMSSVFFNKGENCIAAGRLFVEDS
IHDEFVRRVVQEVRKMKVGNPLDRDTDHGPQNHHAHLMKLMEYCQCGVKEGATLVCGGNQ
IPRPGFFFEPTVFTDVEDHMFIAKEESFGPVMIISRFADGDVDAVLSRANATEFGLASGV
FTRDINKALYVSDKLQAGTVFVNTYNKTDVAAPFGGFKQSGFGKDLGEAALNEYLRVKTV
TFEY
NT seq 2715 nt NT seq  +upstreamnt  +downstreamnt
atgaagattgcagtgattggacagagcctgtttggccaggaagtttacggccacctgagg
aaggagggccacgaagtggtgggtgtgttcactgttccagataaggatgggaaggccgac
cccctgggtctggaagctgagaaggatggagtgccggtattcaaattctcccggtggcgc
gcaaaaggacaggctttgcctgaagtggtggcaaaataccaagctttgggggccgagctc
aacgtcctgcccttctgcagccagttcatccccatggagataatcaatgccccccggcat
ggctccatcatctatcacccgtcactgctccctagacaccgaggggcctcggccatcaac
tggaccctcattcacggagataagaaagggggcttttccatcttctgggcggacgatggt
ctggacaccggggaccttctgctgcagaaggagtgtgaggtgctcccagatgacaccgtg
agcacgctgtacaaccgcttcctcttcccagaaggcatcaaagggatggtgcaggccgtg
aggctgatcgctgaaggcaaagcccccagactccctcagcctgaggaaggagccacctat
gaggggattcagaagaaggagacggccaagatcgactgggaccagccggcagaggctatt
cacaactggatccgtgggaacgacaaggttccaggagcctggacagaggcctgtgaacct
ctgcagaaactgacatttttcaactcaacgctgaatacttcaggcctggtgcccgaggga
gatgctttgcccatcccaggagcccatcggccaggggtggtcaccaaagcaggactcatc
ctctttgggaatgatgacaaaatgctactggtgaagaacattcagctggaggatggcaaa
atgatcctggcctcgaacttctttaaaggggcagccagcagtgcccttgaactgacagag
gcggagctggttactgcagaggctgtgcggagtgcttggcagcggatcctccccaatgtc
ctggaggttgaagactccactgatttcttcaagtcaggggccgcatctgtggatgttgtg
aggctggtggaggaagtgaaggagctgtgtgatggcctggagttagaaaatgaagatgtg
tacatggcaaccacctttggggacttcatccagctgttagtgaggaagctgcgaggggat
gatgaggagggcgagtgcagcattgactacgtggaaatggcagtgaacaagcgcaccctc
cacatgccccaccagctcttcatcgggggggcattcgtggatgccgagggcgccaagacc
tttgagaccatcaatcccaccgatggaagtgtcatctgccaggtatccctggcccaagtc
accgacgttgacaaggcagtggccacagccaaggatgcctttgagaatggacggtggggg
aagatcagcgcgcgggaccggggccggctgctgtacaggttggcagatctcatggagcag
caccaggaggagctggccaccattgaggccctggatgcgggtgccgtctacacgctggcc
ctgaagacccacgtgggcatgtccatccagaccttccgctactttgccggctggtgcgac
aagatccagggctccaccatccccatcaaccaggccagacccaaccgcaacctgaccttg
accaggaaggagcctgtcggggtttgtggcatcatcatcccctggaactatcccctgatg
atgctgtcctggaagacagctgcctgcctggctgccgggaacacagtggtgatcaagcca
gctcaggtgaccccactcactgccttgaagtttgcagagctgacattgaaggctggcatt
cccaaaggtgtggtcaacgtccttccaggatctggctccctgatcggccagagactttca
gaccatcccgatgtgaggaaaattgggttcacaggctccacggaggtgggcaagcacatc
atgaaaagctgtgccataagtaacgtgaagaaggtgtccttggaactgggcgggaagtca
cccctcatcatctttgctgactgtgacctcaacaaggctgtgcagatggggatgagctct
gttttcttcaacaaaggagagaactgcattgcagcaggccggctgtttgtggaggactcc
attcatgatgagttcgtgcggagggtggtacaggaggtgcggaagatgaaggtgggcaac
ccgctggacagggacaccgaccacgggccacagaatcaccatgcccacctgatgaagctg
atggagtactgccagtgcggcgtgaaggaaggggccacactggtctgcggtgggaatcaa
atccctcggccagggttcttctttgagccaactgttttcacagatgtggaagaccacatg
ttcatagccaaggaggagtcctttggacctgtcatgatcatctctcggtttgctgatggg
gacgtggacgccgtgctgtctcgggccaatgccacggaatttggcctggcttctggtgtc
ttcaccagggacatcaacaaggccctgtatgtcagtgacaagctccaggcaggcactgtg
tttgtcaacacgtacaacaagaccgatgtggccgctcccttcggaggattcaaacagtct
ggatttggcaaagatctaggagaggcggctctgaacgagtacctgcgggtcaagacggtg
accttcgaatactga

DBGET integrated database retrieval system