KEGG   Macaca fascicularis (crab-eating macaque): 102146667Help
Entry
102146667         CDS       T02918                                 

Gene name
MAOA
Definition
monoamine oxidase A
Orthology
K00274  
monoamine oxidase [EC:1.4.3.4]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Tryptophan metabolism
Drug metabolism - cytochrome P450
Metabolic pathways
Serotonergic synapse
Dopaminergic synapse
Cocaine addiction
Amphetamine addiction
Alcoholism
Module
GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:mcf00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    102146667 (MAOA)
   00330 Arginine and proline metabolism
    102146667 (MAOA)
   00340 Histidine metabolism
    102146667 (MAOA)
   00350 Tyrosine metabolism
    102146667 (MAOA)
   00360 Phenylalanine metabolism
    102146667 (MAOA)
   00380 Tryptophan metabolism
    102146667 (MAOA)
  Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    102146667 (MAOA)
 Organismal Systems
  Nervous system
   04728 Dopaminergic synapse
    102146667 (MAOA)
   04726 Serotonergic synapse
    102146667 (MAOA)
 Human Diseases
  Substance dependence
   05030 Cocaine addiction
    102146667 (MAOA)
   05031 Amphetamine addiction
    102146667 (MAOA)
   05034 Alcoholism
    102146667 (MAOA)
Enzymes [BR:mcf01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     102146667 (MAOA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
X
AA seq 362 aa AA seqDB search
VNRTARRFATLFVNINVTSEPHEVSALWFLWYVKQCGGTTRIFSVTNGGQERKFVGGSGQ
VSERIMDLLGDKVKLNQPVTHVDQSSDNIIIETLNHEHYECKYVINAIPPTLTAKIHFRP
ELPAERNQLIQRLPMGAIIKCMMYYKEAFWKKKDYCGCMIIEDEDAPISITLDDTKPDGS
LPAIMGFILARKADRLAKLHKEIRKKKICELYAKVLGSQEALHPVHYEEKNWCEEQYSGG
CYTAYFPPGIMTQYGRVIRQPVGRIFFAGTETATKWSGYMEGAVEAGERAAREVLNGLGK
VNEKDIWVQEPESKDVPAVEITHTFWERNLPSVSGLLKIIGFSTSVTALGFVVYKYKLLP
RS
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
gtaaacaggactgctaggcggtttgctactctttttgtgaatatcaatgtgacctctgag
cctcacgaagtgtctgccctatggttcttgtggtatgtgaagcagtgtgggggcaccact
cggatattctctgtcaccaatggcggccaggaacggaagtttgtaggtggatctggtcaa
gtgagcgaacggataatggacctcctcggagacaaagtgaagctgaaccaacctgtcact
catgttgaccagtcaagtgacaacatcatcatagagacattgaaccatgaacattatgag
tgcaaatacgtaattaatgcgatccctccgaccttgacggccaagattcacttcagacca
gagcttccagcagagagaaaccagctaattcagcgtcttccaatgggagctatcattaag
tgcatgatgtattacaaggaggccttctggaagaagaaggattactgtggctgcatgatc
attgaagatgaagatgctccaatttcaataaccttggatgacaccaagccggatggatca
ctgcctgccatcatgggcttcattcttgcccggaaagctgatcgacttgctaaactacat
aaggaaataaggaagaagaaaatctgtgagctctatgccaaagtgttgggatcccaagaa
gctttacatccagtacactatgaagagaagaactggtgtgaggagcagtactctgggggc
tgctacacggcgtacttccctcctgggatcatgactcaatatggaagggtgattcgtcaa
cccgtgggcaggattttcttcgcgggtacagagactgccacaaagtggagcggctacatg
gaaggggcagttgaggctggagaacgagcagctagggaggtcttaaatggtctcgggaag
gtgaacgagaaagacatctgggtacaagaacctgaatcaaaggacgttccagcggtagaa
atcactcacaccttctgggagaggaacctgccttctgtttctggcctgctgaagatcatt
ggattttccacatcagtaactgccctgggattcgtggtgtacaaatacaagctcctgcca
cggtcttga

DBGET integrated database retrieval system