KEGG   Macaca fascicularis (crab-eating macaque): 102146720Help
Entry
102146720         CDS       T02918                                 

Gene name
GSTM2, GSTM2-2
Definition
(RefSeq) glutathione S-transferase mu 2
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Platinum drug resistance
Chemical carcinogenesis
Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcf00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    102146720 (GSTM2)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102146720 (GSTM2)
   00982 Drug metabolism - cytochrome P450
    102146720 (GSTM2)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    102146720 (GSTM2)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    102146720 (GSTM2)
  Drug resistance
   01524 Platinum drug resistance
    102146720 (GSTM2)
Enzymes [BR:mcf01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     102146720 (GSTM2)
Transporters [BR:mcf02000]
 Other Transporters
  Pores ion channels [TC:1]
   102146720 (GSTM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
1
AA seq 218 aa AA seqDB search
MPMTLGYWNIRGLAHSIRLLLEYTGSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNL
PYLIDGTHKITQSNAILRYIARKHNLCGETEKEKIREDILENQLMDNRMQLARLCYDPDF
EKLKPEYLEGLPEMLKLYSQFLGKQPWFLGDKITFVDFIAYDVLERNQVFEPSCLDAFPN
LKDFISRFEGLEKISAYMKSSRFLPRPVFTKMAVWGNK
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgcccatgacactggggtactggaacatccgcgggctggcccactccatccgcctgctc
ctggaatacacaggctcaagttacgaggaaaagaagtacacaatgggggatgctcctgac
tatgacagaagccagtggctgaatgaaaaattcaagctgggcctggactttcccaatctg
ccctacttgattgatgggactcacaagatcacccagagcaacgccatcctgcgctacatt
gcccgcaagcacaacctgtgtggggagaccgaaaaggagaagattcgggaagacattttg
gagaaccagcttatggacaaccgcatgcagctggccagactctgctatgacccagatttt
gagaaactgaagccagaatacctggagggacttcctgaaatgctgaagctctactcacag
tttctggggaagcagccatggtttcttggggacaagatcacctttgtggatttcatcgct
tatgatgtccttgagagaaaccaagtatttgagcccagctgcctggatgccttcccaaac
ctgaaggacttcatctcccgatttgagggcttggagaagatctctgcctacatgaagtcc
agccgcttcctcccaagacctgtgttcacaaagatggctgtctggggcaacaagtaa

DBGET integrated database retrieval system