KEGG   Macaca fascicularis (crab-eating macaque): 102147021Help
Entry
102147021         CDS       T02918                                 

Gene name
CTRB1
Definition
chymotrypsinogen B1
Orthology
K01310  
chymotrypsin [EC:3.4.21.1]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Brite
Enzymes [BR:mcf01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.1  chymotrypsin
     102147021 (CTRB1)
Peptidases [BR:mcf01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   102147021 (CTRB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
20
AA seq 262 aa AA seqDB search
MAFLWILSCWALLGTAFGCGVPAIPPVLSGLTRIVNGEDAVPGSWPWQVSLQDKTGFHFC
GGSLISEDWVVTAAHCGVRTSNVVVAGEFDQGSDEENIQVLKIAKVFKNPSFSIFTVRND
ITLLKLATPAVFSQTVSAVCLPSADDDFPTGTVCVTTGWGKTKYNANKIPDKLQQAALPL
LSNVQCRKFWGSKITEMICAGASGVSSCKGDSGGPLVCQKDRAWTLMGIVSWGSGTCSTS
SPGVYTHVTKLIPRVQEILAAN
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atggctttcctctggatcctctcctgctgggccctcctgggcaccgccttcggctgtggg
gtccccgccatcccccccgtgctcagcggcctgaccaggatcgtcaatggggaggacgcc
gtccctggctcctggccctggcaggtgtccctgcaggacaaaaccggcttccacttctgc
ggaggttccctcatcagcgaggactgggtggtcaccgccgcccactgcggggtcaggacc
tccaatgtggtcgtggccggggagtttgaccagggctctgatgaggagaacatccaggtc
ctgaagatcgccaaggtcttcaagaaccccagcttcagcattttcaccgtgcgcaatgac
atcaccctgctgaagctggccacacccgccgtcttctcccagacggtgtccgccgtgtgc
ctgcccagcgccgacgatgacttccccacggggacagtgtgcgtcaccacaggctggggc
aagaccaagtacaacgccaacaagatccctgacaagctgcagcaggcggccctgcccctc
ctgtccaatgtccaatgcaggaagttctggggcagcaagatcaccgagatgatctgcgct
ggggccagcggtgtctcctcctgcaagggtgactccggcggccccctggtctgccagaag
gacagagcctggaccctcatgggcattgtgtcctggggcagtggcacctgctccacctcc
agccctggcgtgtacacccatgttaccaagctcataccccgggtgcaggagatcctggct
gccaactga

DBGET integrated database retrieval system