KEGG   Methylobacterium extorquens CM4: Mchl_0010Help
Entry
Mchl_0010         CDS       T00809                                 

Definition
RecD/TraA family helicase (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
mch  Methylobacterium extorquens CM4
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mch00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Mchl_0010
Enzymes [BR:mch01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Mchl_0010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
9896..12097
Genome map
AA seq 733 aa AA seqDB search
MNTPLRSSAVDGAASLDMLAGSVERVTFHSAETGFCVLKVHARGRRDLVPVVGHAPAIAA
GEWLTASGRWVTDREHGLQFRADTLQVTPPTGIEGIERYLASGQMRGIGPMMAKRIVARF
GEAVFEIIEAEPARLTEVEGIGRKRAARIVKGWAEQKAVREIMIFLHAHGVGTARATRIF
RTYGGDSLKVMAEDPYRLARDIRGIGFRTADAIALRLGLARDAPQRLAAGVSYALQTAMD
EGHCGLPAERLVRLAAELLDVAPDLVRLAAALVLREGREVVADTLRGEPCLFLKGLHGAE
RVIAMRLAERAAGPPPWAAIDFALARPWVEAKTGKTLSASQAEAVGLVLRSKLCVLTGGP
GVGKTSTLDAILRILTAKGVRVLLAAPTGRAAKRMAEQTGLEARTLHRLLEIDPRNGGFQ
RNEENPLDCDLLVIDETSMVDVPLMHALLKAVPERAGLILVGDVDQLPSVGPGQVLADVI
ASGTVPVARLTEIFRQAAQSRIVVNAHSINTGRMPAAPAKGEDSDFYLVEIEDADEGVET
LIELVTRRIPRRFGLDPTHDIQVLTPMIRGSLGSRNLNNALQRVLNPSPSAEVERFGWRF
APGDRVMETRNDYDRDVFNGDLGTISAIDAEEEALVVDFDGRAVIYPFNELDTLVPAFAT
TIHKAQGSEYPAVVIPVVTQHRTMLARNLLYTGVTRGRRLVVLIGQRRALAMAVREGASR
RRWTKLREWLDAA
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atgaatacgcccctccgctcctcggccgtcgatggtgccgcgtccctcgacatgctcgcc
ggctcggtcgagcgggtgacgttccacagcgccgagaccggcttctgcgtcctcaaggtc
catgcccgcggccggcgcgacctcgtgccggtggtgggccatgcgcccgccatcgccgcc
ggcgagtggctgacggcttccgggcgatgggtcacggaccgtgagcacggcctccagttc
cgcgccgacacgctccaagtgacgccgcccacggggatcgagggcatcgagcgctacctc
gcatccgggcagatgcgcggcatcggcccgatgatggccaagcgcatcgtcgcccgcttc
ggggaggcggtgttcgagatcatcgaagccgagcccgcccgcctcaccgaggtcgagggc
atcggccgcaagcgcgccgcgcgcatcgtcaagggctgggccgagcagaaggccgtgcgg
gagatcatgatcttcctgcacgcccacggcgtcggcaccgctcgggcgacccggatcttc
cgcacctatggcggggattccctgaaggtcatggccgaggatccctatcggctcgcccgc
gacatccgcggcatcggcttccgcacggcggacgccatcgccctgcgcctcggcctcgcc
cgcgacgcgccgcagcggcttgctgccggtgtctcctacgcactccagacggcgatggat
gagggccattgcgggcttcccgccgagcggctggtgcgcctcgctgccgagcttctcgac
gtcgcgcccgatctcgtccggctcgccgcggcgctcgtcctgcgcgagggccgcgaggtc
gtcgcggatacgctgcgcggcgagccctgcctgttcctcaagggcctgcacggcgccgag
cgcgtcatcgcgatgcggctggccgagcgcgccgccggccccccaccctgggccgcgatc
gacttcgcgctggccaggccctgggtcgaggcgaagaccggaaagacgctgtccgcctcg
caggctgaggcggtcgggctggtgctccgctcgaagctctgcgttctcaccggcggcccc
ggcgtcggcaagaccagcaccctcgacgcgatcctgcgcatcctcaccgccaagggcgta
cgggtgctgctcgccgcccccaccggccgcgcggccaagcgcatggccgagcagaccggg
ctggaagcacgcacgctccatcgcctgctggagatcgacccgcgcaatggcggctttcag
cgcaacgaggaaaacccgctcgattgcgatctcctcgtcatcgacgagacctcaatggtc
gacgtgccgctgatgcatgccctcctcaaggcggtgccggagcgagcgggcctgatcctc
gtcggtgatgtcgaccagcttccctcggtcggacccggacaggtgctggccgacgtgatt
gcctccgggacggtgccggtggcgcgtctcaccgagatttttcgtcaggcggcgcagagc
cggatcgtcgtcaacgcccacagcatcaacaccgggcggatgccggctgcgcccgccaag
ggcgaagacagcgacttttacctcgtcgagatcgaggacgcggacgagggcgtggagacg
ctgatcgaactcgtcacccgccgcatcccccgccgcttcggcctcgatcccacccacgac
atccaagtgttgacgccgatgatccgcggctcgctcggcagccgcaacctcaacaacgcc
cttcagcgcgtgttgaatccgtcgccctcggcggaggtcgagcgcttcggctggcgcttt
gcgcccggcgaccgggtgatggagacccgcaacgactacgaccgcgacgtgttcaacggc
gacctcggtacgatcagcgccatcgatgcggaggaagaggcgctcgttgtcgatttcgac
ggtcgcgcggtgatctaccccttcaacgaactcgacacgctggtgccggccttcgccacg
acgatccacaaggcgcagggctcggaatatccggccgtggtgatcccggtggtgacccag
catcgtacgatgctggcgcgcaacctgctctataccggcgtcacccgcgggcgccgcctc
gttgtgctgatcggccagcgccgggcccttgcgatggcggtccgcgaaggggcctcgcgg
cggcgctggaccaagctgcgagagtggctggacgccgcctga

DBGET integrated database retrieval system