KEGG   Methylobacterium extorquens CM4: Mchl_0048Help
Entry
Mchl_0048         CDS       T00809                                 

Definition
(GenBank) peptidase M42 family protein
Organism
mch  Methylobacterium extorquens CM4
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(51543..52610)
Genome map
AA seq 355 aa AA seqDB search
MDHESIEFLRALANVPSPSGYEQGAAKLFREYTQRYADRVSLDSHGNIIAAVNPDAPMKI
MLAAHMDEIGFVVHYIDEAGLLYFSAIGGHDSTIPPGQRVWVYGSERTPGVVGRKASHLF
DEEEQKKKPKLTDLWIDIGATSRAQAEAVVRLGDPITYQYEFQPLLGDRAAARGFDNKAG
LFVVAEALRSLSEEGGLAPGVGVYFVASVQEEIGSRGARTSAFSIAAQTGLAIDVDHAID
YPGVSKTQHGELKIGDGPSVSRGPNTNPVVFDLLSRAAKEEGIPFQVSVSPSATPTDANA
MQLNRGGMAVGLVGVAIRYMHTPCELLSLTDLDQCIRLTSAYCRRVTQDTDFSPY
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggatcatgagtcgatagaattcctgagagctcttgccaacgttccgtcccctagcggt
tacgagcagggagctgcaaagctctttcgagaatacacgcagcgctatgcggatcgcgtg
agcctagattcgcatggtaacattatagcagcggtcaatcctgacgcgccgatgaagatc
atgcttgcggcgcatatggatgagatcgggttcgttgtgcactacatagatgaggccggg
cttctctatttcagcgccattggcgggcacgacagcactattccgccgggccagagggtc
tgggtatatggaagtgagcgcactcccggcgttgtcgggcgcaaggctagtcatcttttc
gacgaagaggagcaaaagaaaaaaccaaagttaaccgacttatggattgacataggtgcc
acctcgcgggcgcaagctgaagctgttgtgcgacttggcgatccgattacatatcagtac
gaatttcagcccttgctgggagatcgcgctgcggcaagagggtttgacaacaaggcaggc
ctgtttgttgtagctgaagctttgcgcagcctcagtgaggagggaggtctcgcacctggc
gttggcgtctatttcgtcgcgtcggttcaggaagaaatcggatcgcgtggcgcgcgaacc
tcagccttcagcatagctgcacaaactggacttgccatcgatgtggatcacgccatcgac
tatccgggcgtgagtaagacacagcacggagagctcaagattggcgacggtccaagcgtg
tcccgcgggcctaacacgaacccggttgttttcgatcttctgtcgagggcagcgaaggaa
gagggcatcccgtttcaggtaagtgtctccccatccgccacgccgacagatgccaatgcg
atgcagcttaatagaggaggaatggctgttggacttgtgggagttgcgatccgttacatg
catactccatgcgaattgttgagcctaacagatttggatcagtgcatccgcttgacgtct
gcgtactgtcgacgcgtaactcaagatacggatttttctccttactag

DBGET integrated database retrieval system