KEGG   Methylobacterium extorquens CM4: Mchl_0118Help
Entry
Mchl_0118         CDS       T00809                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mch  Methylobacterium extorquens CM4
Pathway
mch00260  Glycine, serine and threonine metabolism
mch00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mch01100  Metabolic pathways
mch01110  Biosynthesis of secondary metabolites
mch01130  Biosynthesis of antibiotics
mch01230  Biosynthesis of amino acids
Module
mch_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mch00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mchl_0118
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mchl_0118
Enzymes [BR:mch01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mchl_0118
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ACK81068
UniProt: B7L1H4
Position
complement(112922..114163)
Genome map
AA seq 413 aa AA seqDB search
MTLNPAPNSFRTGPDERGRFGIFGGRFVAETLMPLILDLEKAYADAKADPSFKADMESYG
THYIGRPSPLYFAERLTEHLRAQAPAGQGAKIFFKREELNHTGSHKVNNVLGQILLARRM
GKPRIIAETGAGQHGVATATLCARFGLKCVVYMGAVDVERQAPNVFRMKMLGAEVIPVQS
GTRTLKDAMNEALRDWVTNVSDTFYCIGTVAGPHPYPAMVRDFQSVIGIETKQQMLEMEG
RLPDSLIACIGGGSNAMGLFHPFLDDRDVEIYGVEAAGHGVQSGLHAASLTGGRPGVLHG
NRTYLLMNEDGQIADAHSISAGLDYPGIGPEHAWLHEMGRVTYLSATDAETLEAFKLCSM
LEGIIPALEPAHALSKVMELAPTKPAEHLMVLNLSGRGDKDIPQVAQIFGQTL
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
gtgacgctgaaccccgctcccaattccttccgcaccgggccggatgagcgcggtcgcttc
ggcatcttcggcggccgcttcgtggccgagacgctgatgccgctgattctcgatctcgag
aaggcctatgccgacgccaaggccgacccgtcgttcaaggcggatatggaatcctacggc
acccactacatcggccgaccgagcccgctctactttgccgagcgcttgaccgagcatctg
cgcgcccaggccccggcggggcagggggcgaagatcttcttcaagcgcgaggagctgaat
cacactggctcgcacaaggtgaacaacgtcctcggccagatcctgctcgcccgccgcatg
ggcaagccgcggatcatcgccgagaccggcgcgggccagcacggcgtcgcgacggcgacg
ctctgcgcccgcttcggcctgaaatgcgtggtctatatgggcgccgtcgatgtcgagcgg
caggccccgaacgtgttccgcatgaagatgctcggtgccgaggtgatcccggtgcaatcc
ggcacgcgcacgctcaaggacgcgatgaacgaggccctgcgcgactgggtcaccaacgtc
tccgacaccttctactgcatcggcaccgtggccggcccccatccctatccggcaatggtg
cgcgatttccaatcggtgatcggcatcgagacgaagcagcagatgcttgaaatggagggc
cgcctgccggactcgctcatcgcctgcatcggcggcggctcgaacgccatgggcttgttc
caccccttcctcgatgaccgcgacgtcgaaatctacggcgtcgaggcagccgggcacggc
gtgcagagcggcctccacgccgcctcgctcaccggcggccgcccgggcgtgctgcacggc
aaccgcacctacctgctgatgaacgaggacggccagatcgccgacgcccactcgatctcg
gcgggcctcgattatcccggtatcggccccgaacacgcatggctgcacgagatgggccgg
gtcacctatctgtcggcgaccgatgcggagacgctggaggcgttcaagctctgctcgatg
ctggaaggcatcatcccggctctggagcccgcgcacgcgctgtcgaaggtgatggaactg
gcgccgaccaagccggcggagcacctgatggtgctgaacctctccggccgcggcgacaag
gacatcccgcaggtggcgcagatcttcggtcagacgctctga

DBGET integrated database retrieval system