KEGG   Methylobacterium extorquens CM4: Mchl_0360Help
Entry
Mchl_0360         CDS       T00809                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
mch  Methylobacterium extorquens CM4
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:mch00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:mch00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
342978..343532
Genome map
AA seq 184 aa AA seqDB search
MTIRRRDCLAMLAVLAASRAHAAEAGPASAFAFDKPEGGGLPLSAYAGKPILVVNTATAC
GYAPQFVGLQGLWTRFGGRGLTVIAVPSPDFGNQEPLDGAAIADAARKNHGVTFPVTDKT
HVRGPAAHPFYRWAAEQKPGQSPQWNFHKYLVGRDGTLRAAFATQVDPSDPRIVSAIVAE
LGQA
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgacgattcgccgccgcgactgcctcgcgatgctcgccgttctcgccgcgagccgcgcc
catgccgcggaagccgggccggcgagcgccttcgccttcgacaagccggaggggggcggc
cttccgctctcggcctatgccggcaaacccatcctcgtggtcaacaccgccacggcctgc
ggctacgctccgcaattcgtcggccttcaaggtctatggacccgcttcggcgggcggggc
ctgacggtgatcgcggtgccctcgcccgatttcggcaatcaagagccgctcgacggagcc
gccatcgccgatgccgcgcgaaagaaccacggcgtcaccttcccggtcacggacaagacc
catgtgcgggggccggccgcccatccgttctaccgctgggcggcggagcagaagccgggg
cagagcccgcaatggaacttccacaagtatctcgtcggccgtgacggtaccctgcgcgcc
gccttcgcgacccaggtcgatccgagcgatccgcgcatcgtcagcgccatcgtcgcggaa
ctgggacaggcctga

DBGET integrated database retrieval system