KEGG   Methylobacterium extorquens CM4: Mchl_0386Help
Entry
Mchl_0386         CDS       T00809                                 

Definition
(GenBank) cytochrome c class I
  KO
K08738  cytochrome c
Organism
mch  Methylobacterium extorquens CM4
Pathway
mch02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mch00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Mchl_0386
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: ACK81322
UniProt: B7L044
Position
374954..375871
Genome map
AA seq 305 aa AA seqDB search
MDSFELNKVAGAVLGALLFAVGSGFVAELIYHPKPAGSAGYPLPEPEPKSGGAAAEAPKA
EPIAVRLASADAEKGKGGTKACQACHSFEKGGPNKVGPDLWEIVEREKAHAAGFDYSAAL
KEKGGTWTYEDLDHFLESPKGYVKGTKMAFAGIGSPTDRANVIAYLRTLADSPKPLPAAE
KKAETAPAADKKAETEKPAEGKPDAKKAAEEKKPAGTKPVESATGDKSKTPETNAPQGNT
QSGDGKDTARPVPAPQVQPQRNEVAPTQAPEAKPSGDIPTKADPGSESTPATEPPAKPDP
DAPKP
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggattccttcgagctgaacaaggttgcgggcgcggtcctgggtgccctcctgttcgcg
gttgggtcgggcttcgtggcggagctgatctatcacccgaagcccgccggaagcgccggc
tatccgctgccggagcctgagccgaagagcggtggcgccgcggcggaagcgccgaaggcc
gagcccatcgccgtgcggcttgccagcgccgatgccgagaagggcaagggcggcaccaag
gcctgccaggcctgccacagcttcgagaagggcggcccgaacaaggtcggccccgatctc
tgggagatcgtggagcgcgagaaggcgcatgccgccggcttcgattactccgccgcgctc
aaggagaagggcggcacctggacctacgaggatctcgaccacttcctcgaaagcccgaag
ggctacgtgaagggcaccaagatggcgtttgccggcatcggctcgccgacggaccgcgcc
aacgtcatcgcctatctgcgcacgctcgccgacagcccgaagccgctgccggccgccgag
aagaaggctgaaacggcgccggcggccgacaagaaggccgagaccgagaagccggccgag
ggcaaacccgacgctaagaaggccgccgaggagaagaagccggctgggaccaagccggtg
gaaagcgcgacgggcgacaagagcaagacgcccgagaccaacgcgccgcagggcaacacc
caatcgggtgacggcaaggacaccgcccgcccggttccggcaccgcaggtccagccccag
cgcaacgaggttgccccgacgcaggcgcccgaggccaagccctcgggggacatcccgacc
aaggcggatccgggctccgagtccacgccggccaccgagccgccggccaagcccgacccc
gacgcgcccaagccgtaa

DBGET integrated database retrieval system