KEGG   Methylobacterium extorquens CM4: Mchl_0479Help
Entry
Mchl_0479         CDS       T00809                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
mch  Methylobacterium extorquens CM4
Pathway
mch00220  Arginine biosynthesis
mch00330  Arginine and proline metabolism
mch01100  Metabolic pathways
mch01110  Biosynthesis of secondary metabolites
mch01130  Biosynthesis of antibiotics
mch01230  Biosynthesis of amino acids
Module
mch_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:mch00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    Mchl_0479
   00330 Arginine and proline metabolism
    Mchl_0479
Enzymes [BR:mch01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Mchl_0479
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ACK81414
UniProt: B7L0D6
Position
471554..472480
Genome map
AA seq 308 aa AA seqDB search
MPAPSTIDLIGAPIEIGTSEPGAVMGPAALRTAGLLRVLRDLGFTVRDQGDLAPDCTPGQ
RDLPAIRAWMTEISRAVETALDGGSLPLVAGGDHSLSLGSIDGALRHCGRTGRPVFVLWL
DAHADFNTLETSPSGNVHGMPLAALCGEPGFDDLFAGGERPLLDPRRIHLFGLRSIDAGE
RAIVTQRQVNVIDMRTIDEFGVVAPLRRILDRVAAANGHLHVSFDVDFLDPAIAPGVGTT
VPGGATFREAHLIMEMLCDSGLVGSLDVVELNPFLDERGRSARALVELVASLFGRRIIDR
PTKPPLEA
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcaccctccacgatcgacctcatcggcgcaccgatcgagatcggaacgagcgag
cccggagcggtgatggggccggcagccctgcgcacggcgggattgctgcgggtgcttcgg
gatctgggcttcacggtccgcgaccagggcgatctcgctcccgactgcacgccgggccag
cgcgatctcccggcgatccgggcctggatgaccgagatctcgcgggcagtggaaacggcc
ctggacggcggaagcctgccgctcgtggcgggcggcgaccacagcctatcgctcggctcg
atcgacggggcgctgcgccattgcggccgcaccgggcggccggtcttcgtgctgtggctc
gacgcccatgccgacttcaacaccttggagacatcgccctccggcaacgtccacggcatg
ccgctggctgccctctgcggcgagcccggtttcgacgacctgttcgccggtggtgaacgc
ccgctgctcgatccgcggcgcatccacttgttcggcctgcgctcgatcgatgcaggcgag
cgggccatcgtcacgcagcggcaggtgaacgtcatcgatatgcggaccatcgacgagttc
ggcgtggtcgccccgctgcgccgcatcctcgaccgggtcgcggccgcgaacggccacctg
catgtcagcttcgacgtggatttcctcgaccccgccatcgcacccggcgtcggcacgacg
gtgccgggcggggcaacgttccgcgaggcgcatctcatcatggagatgctgtgcgattca
gggctggtcggctccctcgacgtggtggagctgaaccccttcctcgacgagcgcgggcgc
agcgcccgggcgctcgtcgagctggtcgcgagcctgttcggccgccgcatcatcgaccgg
ccgaccaagccgccgctggaggcgtga

DBGET integrated database retrieval system