KEGG   Methylobacterium extorquens CM4: Mchl_0502Help
Entry
Mchl_0502         CDS       T00809                                 

Definition
phosphoketolase (EC:4.1.2.9)
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
mch  Methylobacterium extorquens CM4
Pathway
Pentose phosphate pathway
Carbon fixation in photosynthetic organisms
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mch00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Mchl_0502
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Mchl_0502
Enzymes [BR:mch01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     Mchl_0502
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
497810..500245
Genome map
AA seq 811 aa AA seqDB search
MTEPTNPQGRTAPSSAPLGGEELALIDRYWQAANYLSVGQIYLLDNPLLREPLQPQHIKS
RLLGHWGTTPGLNFIYVHLNRLIKARDLDAIYICGPGHGGPGIVANTYLEGTYSEVYPDI
AQDTEGMRRLFRQFSFPGGIPSHVAPETPGSIHEGGELGYAIVHAFGAVFDNPDLIAACV
IGDGEAETGPLAASWQSNKFLSPVTDGAVLPILHLNGYKIANPTVLGRMRDDELESLFTG
FGYEPFFVEGDQPEPMHRAMAEALDRAVARIKDIQAEARGGGMGFRRPRWPMIVLRSPKG
WTGPKTVDGKRVEGFWRAHQVPVGNARTDDGHRQILEDWMRSYRPETLFDETGRLRPELA
ALAPEGNRRMSANPHANGGLLRRELRCPRWQDFALTVSKPGAEIGEATRTLGRYLRDVIR
LNAEARNFRIMGPDETASNRLDAVFEATDRVWIENIEPYDVSLAHEGRVMEVLSEHLCQG
WLEGYLLTGRHGLFSCYEAFIHIVDSMFNQHAKWLKVSRELGWRRPISSLNYLLTSHVWR
QDHNGFSHQDPGFIDLVANKKSDIVRVYLPPDANTLLWVADHCLQTYDRINVIVAGKQPQ
PQWLGAHEAGLHCEAGIGIWPWAGTDESGLEPDVVMACAGDVPTLETLAAVDLLKQAVPG
LRIRVVNVVDLMTLQSNRDHPHGLTDAAFDSLFTRDKPVIFAYHGYPYLIHRLTYSRANH
ANMHVRGFIEEGTTTTPFDMVVLNELDRFHLAIEAIDRVPGLVTRAAGAKQAFRDRLTAH
KLYIREHGEDMPEIQGWKWPYETRQETGTPH
NT seq 2436 nt NT seq  +upstreamnt  +downstreamnt
gtgactgagccaaccaacccgcaaggacggaccgcgccatcctctgcccccctcggcggc
gaggaactcgccctgatcgaccgctactggcaggcggccaactatctctcggtcggccag
atctacctgctcgacaatccgctgctgcgcgagccgcttcagccgcagcacatcaagtcg
cggcttctcggccattggggcacgacaccgggtctgaacttcatctacgtccacctcaac
cggctgatcaaagcgcgtgatctcgacgcgatctacatctgcggaccaggccatggcggt
cccggcatcgtcgccaacacctacctcgaaggcacctacagcgaggtctatcccgacatc
gctcaggatacggagggcatgcgccggctgttccggcagttctcgttccccggcggcatc
ccgagccacgtcgcgcccgagacccccggctcgatccacgagggcggcgaactcggctac
gccatcgtccatgccttcggcgcggtgttcgacaatcccgatctgatcgcagcctgcgtg
atcggcgacggcgaggccgagaccgggccgctcgccgcctcgtggcagtccaacaagttt
ctgagcccggtcaccgacggcgcggtgctgccgatcctccatctcaacggctataagatt
gccaacccgaccgtgctcggccggatgcgggacgacgagttggagtccctgttcaccggc
ttcggctacgagcccttcttcgtcgagggcgaccagcccgaaccgatgcaccgggcgatg
gccgaggcgctcgaccgcgcggtggcgcgcatcaaggacatccaggccgaagcgcggggc
ggcggcatgggcttccggcgcccgcgctggccgatgatcgtgctgcgcagccccaagggc
tggaccgggccgaagaccgtggacggcaagcgggtggagggcttctggcgcgcgcaccaa
gtgcccgtgggcaacgcccgcaccgatgacggccaccgccagatcctcgaagactggatg
cggagctaccgccccgaaaccctgttcgacgagaccggccgcctgcgccccgaactcgcc
gccctggcgcccgagggcaaccggcgcatgagcgccaacccccacgccaatggcggtctg
ctacgccgggagctgcgctgtccccggtggcaggatttcgccctcacggtgtccaagccc
ggcgccgaaatcggcgaggcgacccgcaccctcgggcggtatctgcgcgacgtgatccgg
ctcaacgccgaggcgcgcaacttccgcatcatggggccggacgagaccgcctcgaaccgg
ctcgacgcggtgttcgaggcgactgaccgcgtctggatcgagaatatcgagccctacgat
gtcagcctcgcccacgaggggcgggtgatggaggtgttgagcgagcatctctgccagggc
tggctcgaaggctacctgctcaccggccgccacggcctgttctcctgctacgaggcgttc
atccacatcgtcgattcgatgttcaaccagcacgccaagtggctgaaggtgtcgcgcgaa
ctcggctggcgccggccgatctcctcgctcaactacctcctgacctcccatgtctggcgc
caggaccataacggcttcagccaccaggatccgggcttcatcgacctcgtcgccaacaag
aagtcggacatcgtccgcgtctacctgccgccggacgccaacaccctgctctgggtcgcc
gaccactgcctgcagacctatgaccgcatcaacgtgatcgtggccggcaagcagccgcag
ccgcaatggctcggcgcgcacgaggccggtctccattgcgaggcgggcatcggcatctgg
ccctgggccgggacggacgagagcgggctcgaaccggatgtcgtgatggcctgcgccggc
gacgtgccgacgctcgaaaccctggctgccgtcgatctgctgaagcaggccgttccaggc
cttcgcatccgggtcgtcaacgtggtcgacctgatgacgctccagtcgaacagggatcac
ccgcacgggctgacggacgccgcgttcgacagcctattcacccgcgataagccggtgatc
ttcgcctatcacggctatccctatctcattcaccggctgacctattcccgggccaaccac
gccaacatgcatgtgcgcggcttcatcgaggaaggcaccacgacgacgccgttcgacatg
gtggtgctgaacgagctcgaccgcttccacctcgccatcgaggcgatcgaccgggtgccg
gggctggtgacgcgggcggcaggggccaagcaggcgttccgggaccgcctcacggcacac
aagctctatatccgcgagcacggtgaggacatgcccgagatccagggctggaaatggccc
tacgagacgcgccaggaaaccggaaccccgcactga

DBGET integrated database retrieval system