KEGG   Methylobacterium extorquens CM4: Mchl_0559Help
Entry
Mchl_0559         CDS       T00809                                 

Definition
cytochrome-c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
mch  Methylobacterium extorquens CM4
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(555859..556920)
Genome map
AA seq 353 aa AA seqDB search
MGPILPVPVLVAWAIVVCGGAYAVTTCSGAATATVSASQQDLDALKQRFRRPEGVPHPKA
NPMTPEKVALGKALFFDPRLSRSGSVSCATCHNPSLGWSDGLPQAVGFGMAPLPRRTPPV
RNLAWGAAFQWDGRADSLEAQARMPITAPDEMNMSMDLVVERLQAVQDYAPLFRDAFGGE
GAITARNVTMALATFQRTLVSGEAPFDRWASGDESAIGADAKRGFALFTGKAGCAACHST
WRFTDDSFHDIGLKAGDDLGRGKFAPPSVTAMRYAFKTPSLRDLRMQGPYMHDGQLGSLN
AVLDHYVKGGETRASLSFEMKPFEMDERERRDLVAFLKTLKSEPAAITLPQLP
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggggccgatcctaccagttcctgttctggtcgcctgggccatcgtcgtctgcggcggc
gcctatgctgtcaccacgtgctccggcgctgccacggccaccgtcagcgcgtcgcagcag
gacttggacgccctcaagcagcgcttccgccggcccgaaggcgtgccgcacccgaaggcc
aatccgatgaccccggagaaggtggcgctcggcaaggctttgttcttcgatccgcggctc
tcgcgctcgggcagcgtctcttgcgcgacctgtcacaatccaagcctcggctggagcgac
ggcctgccccaggcagtcggcttcggcatggctcccctgccgcggcgtaccccgcctgtc
cgcaatctggcatggggtgccgctttccaatgggacggccgggccgacagcctggaagcg
caggcacgcatgccgatcacggcgcccgacgagatgaacatgtccatggatcttgtcgtc
gagcggctgcaggcggtgcaggactacgcgccgctcttccgcgacgccttcggcggcgag
ggggccatcaccgcgcgcaacgtcacgatggcactcgccaccttccagcggacgctcgtc
tcgggcgaagcgccgtttgaccgctgggcgtcgggtgacgagagcgccattggtgccgac
gcgaagagaggttttgctctgttcaccggcaaggccggctgcgcagcctgccattccact
tggcgcttcacggatgacagcttccacgacatcgggctcaaagctggcgatgacctcggt
cgtggcaagttcgcaccgccaagcgtgacggcgatgcgctacgccttcaagaccccgtca
ctgcgcgacctgcggatgcaaggtccttacatgcacgacggtcagctcggtagcctcaat
gcagtgttggatcactacgtcaagggcggcgagacgcgggcgagcttatccttcgaaatg
aagccgttcgagatggatgaacgggagcggcgcgatcttgttgccttcctcaagacgttg
aaatcagaacccgccgccatcactttaccacaactaccatag

DBGET integrated database retrieval system