KEGG   Methylobacterium extorquens CM4: Mchl_0732Help
Entry
Mchl_0732         CDS       T00809                                 

Definition
fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
mch  Methylobacterium extorquens CM4
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:mch01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:mch01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(728284..729210)
Genome map
AA seq 308 aa AA seqDB search
MTEAPRCTSTTRMIADAHTSAADGHVEWAPAKSLWIGGMLAAALLLGPIFVTPGAVALFL
VTTVITLCAGHSIGMHRLLVHRSFSAKPWVEYVLVYLGTLVGMAGPIGMVRLHDMRDWAQ
RQPACHDLHANRLPLLRDAVLQMHARLVLTHPPLFVVEPRIAGDRIFRWLEASWMLQQLP
WAVLFYAIGGLPWLVWGIPVRVAVSLTGHWLVVHLTHRRGPQGWVVDGESVQGHDLPAAA
WLTFGEAWHSTHHAWPESARLGTEPGQADPGWRLLQGLERLGLVWDLKQPGVLQPRPGVR
KLQGPTTS
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaagcgccccgatgcacctcgacgacccgcatgatcgccgacgcccacacgtcg
gcagctgacggtcacgtggaatgggcgccggccaagtcactttggatcggtggcatgctg
gctgcagccctgttgcttggcccgattttcgtgacacccggggctgtcgcgctgttcctg
gtgacgactgtcatcacgctttgcgcaggccattcgatcggaatgcatcggttgctggtg
catcgcagcttctcggcaaagccctgggtcgaatatgttttggtctacctggggaccttg
gttggaatggcaggtccgattggcatggtccgcctccatgacatgcgcgattgggcgcag
cgccagcccgcctgccacgatctccacgccaatcgacttccgctcctgcgtgacgcggtg
ttgcagatgcacgcccgactcgtactgactcatccccctctgttcgttgtggagccgagg
atcgcaggtgaccggatctttcgttggctggaagcgagctggatgctgcagcaactgcca
tgggccgtcctgttctatgcgataggcgggctgccgtggttggtttggggtattccggtc
cgggtcgccgtatcgttgaccgggcactggcttgtcgtgcacctgacccatcgccgcgga
ccccagggttgggtggtcgatggtgagtccgtccaaggacatgacttaccggcagcggcc
tggctcaccttcggcgaagcttggcattcaacgcatcacgcatggccggagtcggcacgc
cttggaacggaaccaggtcaagccgatccaggctggcggctgctgcaaggcctggaacgt
ctcggcctcgtctgggatttgaagcagcccggcgttctgcaacctcggcccggcgttcga
aagcttcagggaccaacgacctcgtag

DBGET integrated database retrieval system