KEGG   Methylobacterium extorquens CM4: Mchl_0747Help
Entry
Mchl_0747         CDS       T00809                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mch  Methylobacterium extorquens CM4
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:mch00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
742777..743487
Genome map
AA seq 236 aa AA seqDB search
MRIWVSRPEPGASRTARRLAELGHAALVAPVLRIAPSDGPPPTGRFDGLILTSANAAAPL
AAAGLPEAPVFAVGTRTAERAERAGLRSVHCADGDAVSLARLVAAHVRPGGTLLHAAGED
RKAEPAASLTAAGYRVTTWTAYAALAEAALPEPVVQGLMGRDGAPLAAALHFSRRSAEIA
VHLSGKAGLSGAFRALAHYCLSPDVALGLVELGVAAHFVAARPSEEALLAGLAASD
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgcggatctgggtgtcgcggcccgagccgggcgcgagccgcacggcacggcggctagcc
gagctcggccatgcggcgctggtggcgcccgtgctgcggatcgcgccgagcgacgggccg
ccgcccaccggccggttcgacgggctgatcctgacgagcgccaatgccgccgcgccgctc
gccgcagctggtcttcccgaagcaccggtcttcgccgttggcacccgcaccgccgagcgg
gcggaacgggcgggcctgcgctccgtgcactgcgccgacggggacgccgtcagcctggcc
cggctcgttgcagcccatgtgcggccgggcggcaccctcctccacgcggccggcgaggac
cgcaaggccgagcccgccgcgagcctcacggccgcgggctaccgcgtcacgacctggacc
gcctacgcggctctggccgaggcagccctgccggagccggtggtgcaggggctgatgggc
cgggacggcgcgccgctcgccgcggccctgcatttttcgcgacggagcgccgaaatcgcg
gtgcatttatccggcaaagccggtctgagcggagcgtttcgggcgctggcgcattactgc
ctgtctccggacgtggccttgggactggtcgagctcggcgtcgcggcccattttgtagcg
gcgcgcccgagcgaggaagcactccttgccggtctcgcggcttcggactga

DBGET integrated database retrieval system