KEGG   Methylobacterium extorquens CM4: Mchl_0885Help
Entry
Mchl_0885         CDS       T00809                                 

Definition
cytochrome C class I
Orthology
K08738  
cytochrome c
Organism
mch  Methylobacterium extorquens CM4
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:mch00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Mchl_0885
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Mchl_0885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
900457..900819
Genome map
AA seq 120 aa AA seqDB search
MRHLILGAALALLLPVAAHAEGDAAAGEKAFAPCKACHNFEKNGVGPTLKGVVGAKAGEG
ADGYAFSDALKKSGLTWDEANLKEWLTDPKKKVPGTKMVFPGIKDPKKVDDIIAYLKTKS
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcatctcatcctcggcgccgccctcgcgctgctgctgcctgtcgccgcccatgcc
gagggcgatgccgccgccggcgagaaggcgttcgcgccctgcaaggcctgccacaatttc
gagaagaacggcgttggaccgaccctgaagggtgtcgtcggcgcgaaggccggtgagggt
gccgacggctacgccttctccgacgcgctgaagaagtccggcctcacctgggacgaagcc
aacctcaaggagtggctcaccgacccgaagaagaaggtgcccggcaccaagatggtcttc
cccggcatcaaggacccgaagaaggtcgacgacatcatcgcctacctcaagacgaagtcc
tga

DBGET integrated database retrieval system