KEGG   Methylobacterium extorquens CM4: Mchl_1283Help
Entry
Mchl_1283         CDS       T00809                                 

Definition
phosphoketolase (EC:4.1.2.9)
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
mch  Methylobacterium extorquens CM4
Pathway
Pentose phosphate pathway
Carbon fixation in photosynthetic organisms
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mch00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Mchl_1283
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Mchl_1283
Enzymes [BR:mch01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     Mchl_1283
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1308499..1310934)
Genome map
AA seq 811 aa AA seqDB search
MDAILKARRQPKRTARTSELTLIDAYWRAANYLSVGQIYLYDNPLLVERLTKEHIKPRLL
GHWGTTPGLNFIYVHLNRLIKKHDLDVIYITGPGHGGPALIANAYLEGTYSEVYPNISAD
AEGMKRLFKQFSFPGGIPSHVAPETPGSMHEGGELGYSLSHAYGAAFDNPDLIVACVVGD
GEAETGPLATSWHSNKFLNPVSDGTVLPILHLNGYKIANPTVLARISHAELEHLFRGYGY
TPYFVEGHDPAEMHQRMASTMDAVLRDIRRIKSDARDKGFTGRPFWPMIVLRTPKGWTCP
KEIDGRRTEDYWRSHQVPMGEMHDNPAHVRMLEDWMQSYRPAELFDEGGRLRSELAELAP
TGDRRMSANPHTNGGTLLRDLRLPDFHDYAIPVTAPGAAVAESTRVMGRFLRDVMDLNAE
ARNFRLFSPDENNSNRWQDALEVTKRAWVAETYPWDDHLAHDGRVMEMLSEHQCQGWLEG
YLLTGRHGFFSCYEAFIHIIDSMFNQHAKWLKVCNHIPWRRPIGSLNYLLSSHVWRQDHN
GFSHQDPGFIDHVVNKKAEVVRVYLPPDANCLLSVTDHCLRSRNYVNVIVAGKQPAPQWL
TMDQAVKHCTAGLGIWEWASNDRGSEPDVVMACCGDVPTLETLAAVDLLRCHAPDLKVRV
INVVNLMKLQPDTEHPHGLSDQDFDALFTTDKPVVFAFHGYPWLIHRLIYRRHGHSNFHV
RGYKEEGTTSTPFDMCVMNDMDRFHLVSDVIDRVPGLAARAAYAKQAIRDKLIDHRAYIH
RHGDDMPEVSGWSWSPMATTRGLGSTESDNV
NT seq 2436 nt NT seq  +upstreamnt  +downstreamnt
atggacgcgatcctcaaagctcggcggcagcccaagcgcacggcgcggacatccgagctg
accctaatcgatgcctattggcgggcggcaaactacttgtcggtcggtcagatctacctc
tacgacaacccgctactggtggaacggctgaccaaggagcacatcaaaccgcgtctgctc
ggccactggggaaccactccgggtttgaatttcatctatgttcatctgaatcgtcttatt
aaaaagcatgatcttgatgttatttatattacagggccggggcatggcggccccgctttg
attgccaacgcgtacctcgagggaacttacagcgaagtctatccgaacatctccgccgat
gctgagggcatgaagcgcctcttcaagcagttctccttcccaggcggcatcccgagccat
gtggctcctgaaacaccgggctcgatgcacgaaggcggagagctgggctattccctctcg
cacgcctacggcgccgcgttcgacaaccccgacctcatcgtcgcttgcgtcgtcggcgat
ggcgaggccgagaccgggcctcttgccacaagctggcattcgaacaaatttctcaacccg
gtgagcgatgggacggttctgccgatcctccacctcaacggctacaagattgccaacccg
actgtactggccagaattagccacgcggagcttgaacatctcttccgtgggtatgggtac
accccctacttcgtggaaggacatgatccggccgagatgcaccagcgcatggcctccacc
atggatgctgtcctgcgggacattcgccggatcaagtcggacgcgcgcgacaagggtttc
acaggccggccgttctggccgatgatcgttcttcggacgccaaaaggatggacatgtccg
aaggaaatcgatggacggcgcacagaggattactggcgctcgcaccaagtgcccatgggc
gagatgcacgacaatcccgcccatgtgcgcatgctcgaagactggatgcaatcttatcgg
cccgccgagctcttcgacgaaggcggccgacttcgctccgaacttgccgagcttgccccg
acgggcgaccgccgcatgagcgccaatccgcataccaatggaggcactctgctccgcgac
ctgcggctcccggattttcacgactatgcaataccggtgaccgcccccggtgccgccgtc
gccgagtccacgcgcgtgatgggacgcttcctccgcgacgtcatggacctgaacgccgaa
gcgcgaaacttcaggctcttcagtccggacgaaaataactcaaatcgctggcaggacgcg
ctcgaggtgaccaagcgcgcctgggtggccgagacgtatccgtgggatgatcacctcgcg
catgacggccgcgtgatggagatgctgagcgagcatcaatgtcagggctggctcgaaggc
tatctgctgacgggtcggcacggcttcttctcgtgctacgaggccttcatccacatcatc
gactcgatgttcaatcagcacgccaaatggctgaaggtctgcaaccatattccgtggcgg
cgacccattgggtcgttgaactaccttctctccagccacgtctggcgtcaggatcacaac
gggttcagccatcaggatccaggcttcatcgaccatgtcgtgaacaagaaagccgaggtc
gttcgtgtctacttgccgccggatgcgaattgtctgctttccgtaaccgaccactgcttg
cgaagccgcaactacgtcaacgtgatcgtcgcgggtaaacagccggcaccccagtggctc
acgatggatcaggcggtcaagcactgcacggccgggcttgggatctgggaatgggcgagc
aacgaccgcggcagcgagccggacgtcgtgatggcgtgctgtggggatgtgccgaccctt
gagacgctcgcggccgtcgacctcctccgctgccatgcgccggatctcaaggtgcgcgtc
atcaacgtcgtgaacctgatgaagctgcagcccgacacggagcatccacacggcctgtca
gatcaggatttcgatgcactgttcacgacggacaaaccggtcgtcttcgcctttcacggg
tatccgtggctcattcaccggctgatttaccgacgtcacggacacagcaacttccatgtg
cgtggctacaaagaggaaggcacgacgagcacgccgttcgacatgtgcgtgatgaacgac
atggatcggttccatctggtcagcgatgtcatcgaccgcgtgccgggcctagccgctcgg
gcggcctacgccaagcaggcgatccgggacaagctgatcgaccatcgcgcgtacattcat
cgccacggcgacgacatgccggaagtatccggctggtcctggagcccgatggcgacgacg
cgcggtctcggctcgacggagagtgacaatgtgtga

DBGET integrated database retrieval system