KEGG   Methylobacterium extorquens CM4: Mchl_1807Help
Entry
Mchl_1807         CDS       T00809                                 

Definition
inositol monophosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
mch  Methylobacterium extorquens CM4
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mch00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Mchl_1807
Enzymes [BR:mch01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Mchl_1807
Transfer RNA biogenesis [BR:mch03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    Mchl_1807
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1860808..1861731)
Genome map
AA seq 307 aa AA seqDB search
MTAPAPILADPPASLTAPVPAAMRDAIAEQLAGIACEAGRILRGYHGSDCPHVIKPDGSP
ASLADTRSEELIVAALGRAFPGIPVIAEETSGTAQPAPLFFLVDPLDGTRDFLAGSEQYC
VNIGLVQGDRPIAAALAAPGLGRVWAAGTTAREAPIREGRPGAFRPVGVRAAPADGLVAL
VSRLHGDSDTDACLDRLPIAERRVTSSALKFCLIAAGEADLYVRCVPTMEWDTAAGDHVL
TMAGGRVVGPDGATITYGHHARFYRNGPFAALASAAYRDALTLPQQSAVSYFDRRRAGAA
VEAAGQE
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcccccgctcccattctggccgatccgccggcgtccctgacggctcccgttccg
gcggcgatgcgggacgccatcgcggagcagctggccggaatcgcctgcgaggctgggcgc
attctgcggggttatcacggcagcgactgcccgcacgtcatcaagcccgacggctcgccg
gccagcctcgccgacacccgctccgaagagctgatcgtcgcggccctgggacgggctttc
cccggcatcccggtgatcgccgaggagacttccggcaccgcgcagcccgcacccttgttc
ttcctcgtcgatccgctcgacggcacccgcgacttcctcgccggcagcgaacagtactgc
gtcaatatcggcctcgttcagggagaccgcccgatcgccgccgctttggcggcgccgggg
ctcggccgggtctgggcggcgggcaccaccgcccgcgaggcgccgatccgcgaggggcgt
ccgggcgcgttccggccggtgggcgtgcgcgcggcccccgccgacggtctcgtcgccctc
gtcagccgcctgcacggcgacagcgacaccgatgcctgcctggaccggctgccgatcgcc
gagcggcgggtcacatcctcggcgctcaagttctgcctgatcgcggcgggcgaggcggat
ctctacgtgcgctgcgtccccaccatggagtgggacacggcggccggcgaccacgtgctg
accatggccggcgggcgcgtcgtcgggcccgacggcgccacgattacctacggccatcat
gcccgcttctaccgcaacggccccttcgcggcgctggcctcggcggcctaccgcgacgcg
ctcaccctgccgcagcagagcgccgtgtcctatttcgaccgccgccgcgcgggggcggcg
gttgaggccgccgggcaggaatag

DBGET integrated database retrieval system